Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WNG6

Protein Details
Accession L8WNG6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
28-50GSALKASKSHKKSKTPQEWSPELHydrophilic
NLS Segment(s)
PositionSequence
69-83KVKKPKPAVPKAPRA
Subcellular Location(s) plas 16, E.R. 4, mito 3, cyto 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSPYSTSSAASSQTAVAEPQAQLLEHSGSALKASKSHKKSKTPQEWSPELRQAVAHDIDDFFGGPEPVKVKKPKPAVPKAPRADRGHSASNSLGTALPPSYELPSHLAPVSKPRTIARSFFLYGFIFPPFWVIGACILWSKLRPDPEPTIEPLPKEIEAGYGRAPSEAYKRAEYKLLRHTELVWARRCLIAAITFVLVVIVIIVGTRVAGIGAFASSDSKTMPRPIIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.13
4 0.14
5 0.13
6 0.14
7 0.14
8 0.13
9 0.13
10 0.15
11 0.15
12 0.11
13 0.12
14 0.11
15 0.1
16 0.12
17 0.15
18 0.13
19 0.17
20 0.24
21 0.33
22 0.4
23 0.5
24 0.57
25 0.64
26 0.73
27 0.79
28 0.84
29 0.82
30 0.82
31 0.8
32 0.79
33 0.75
34 0.71
35 0.67
36 0.56
37 0.48
38 0.42
39 0.35
40 0.32
41 0.28
42 0.21
43 0.15
44 0.15
45 0.15
46 0.14
47 0.12
48 0.08
49 0.07
50 0.07
51 0.06
52 0.07
53 0.1
54 0.12
55 0.18
56 0.24
57 0.27
58 0.35
59 0.43
60 0.49
61 0.57
62 0.64
63 0.69
64 0.71
65 0.78
66 0.77
67 0.76
68 0.77
69 0.71
70 0.66
71 0.6
72 0.56
73 0.52
74 0.46
75 0.4
76 0.33
77 0.29
78 0.24
79 0.2
80 0.15
81 0.09
82 0.09
83 0.07
84 0.06
85 0.06
86 0.07
87 0.07
88 0.07
89 0.08
90 0.11
91 0.11
92 0.12
93 0.12
94 0.12
95 0.11
96 0.19
97 0.22
98 0.19
99 0.2
100 0.2
101 0.25
102 0.26
103 0.28
104 0.22
105 0.23
106 0.23
107 0.22
108 0.23
109 0.19
110 0.17
111 0.16
112 0.14
113 0.1
114 0.09
115 0.1
116 0.07
117 0.07
118 0.07
119 0.06
120 0.06
121 0.06
122 0.07
123 0.06
124 0.06
125 0.07
126 0.07
127 0.1
128 0.12
129 0.16
130 0.17
131 0.23
132 0.27
133 0.31
134 0.33
135 0.34
136 0.37
137 0.34
138 0.33
139 0.29
140 0.27
141 0.22
142 0.2
143 0.17
144 0.15
145 0.14
146 0.15
147 0.15
148 0.14
149 0.14
150 0.14
151 0.14
152 0.12
153 0.16
154 0.21
155 0.23
156 0.26
157 0.28
158 0.3
159 0.36
160 0.37
161 0.38
162 0.41
163 0.44
164 0.41
165 0.4
166 0.4
167 0.42
168 0.47
169 0.47
170 0.42
171 0.38
172 0.38
173 0.38
174 0.37
175 0.28
176 0.23
177 0.19
178 0.15
179 0.15
180 0.14
181 0.13
182 0.12
183 0.11
184 0.08
185 0.06
186 0.04
187 0.03
188 0.02
189 0.02
190 0.02
191 0.03
192 0.03
193 0.03
194 0.03
195 0.03
196 0.03
197 0.03
198 0.04
199 0.04
200 0.04
201 0.05
202 0.06
203 0.07
204 0.08
205 0.09
206 0.11
207 0.15
208 0.2