Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3RV36

Protein Details
Accession E3RV36    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
137-158RPIAVPKRGRGRPKKADVKQARBasic
NLS Segment(s)
PositionSequence
141-152VPKRGRGRPKKA
197-199RKR
Subcellular Location(s) nucl 14, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032054  Cdt1_C  
IPR038090  Cdt1_C_WH_dom_sf  
Gene Ontology GO:0007049  P:cell cycle  
KEGG pte:PTT_13011  -  
Pfam View protein in Pfam  
PF16679  CDT1_C  
Amino Acid Sequences MSPIAPGQLPTELVNLLALHSSFLTALSLHYAHNGTSTPADLRDLVASTTLVWRQRKVTNDDIRLLIGILDHGPSGHNNPYYLSDYGRGKICIEIKDDSPMMGGMTHMNEEGLQDMFKQGLDTLWSEWCTSQKMMARPIAVPKRGRGRPKKADVKQARMETFLDETSMSKFLAQLPLADITTCESLTALAPAQEKGRKRLREFKESVQQGRAQKKTRAASGKENEPTPTTSAQPAQPKITEFAAVRKTNLLDRILAKQEAAKAGPAAPSPAELQRKAALQRTPEVLGVLSLLCANRPGARVSFSTTTLLQALQGSIRSPISKEEAMKCVEVLADEVAPGYVSVVSMGSIYSVVINQMMRPTDIKSRLIALGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.12
3 0.11
4 0.11
5 0.1
6 0.09
7 0.09
8 0.09
9 0.08
10 0.08
11 0.08
12 0.07
13 0.07
14 0.1
15 0.11
16 0.1
17 0.14
18 0.14
19 0.13
20 0.15
21 0.15
22 0.13
23 0.14
24 0.15
25 0.14
26 0.14
27 0.16
28 0.15
29 0.15
30 0.15
31 0.15
32 0.14
33 0.13
34 0.12
35 0.11
36 0.15
37 0.17
38 0.22
39 0.24
40 0.27
41 0.31
42 0.36
43 0.42
44 0.46
45 0.52
46 0.55
47 0.57
48 0.58
49 0.54
50 0.49
51 0.42
52 0.35
53 0.25
54 0.15
55 0.11
56 0.08
57 0.07
58 0.06
59 0.06
60 0.07
61 0.08
62 0.12
63 0.16
64 0.17
65 0.17
66 0.18
67 0.22
68 0.25
69 0.25
70 0.22
71 0.22
72 0.24
73 0.26
74 0.28
75 0.24
76 0.21
77 0.25
78 0.28
79 0.26
80 0.27
81 0.27
82 0.25
83 0.28
84 0.28
85 0.23
86 0.19
87 0.16
88 0.13
89 0.1
90 0.1
91 0.07
92 0.07
93 0.08
94 0.07
95 0.07
96 0.07
97 0.07
98 0.08
99 0.07
100 0.06
101 0.05
102 0.06
103 0.06
104 0.06
105 0.06
106 0.05
107 0.05
108 0.07
109 0.08
110 0.09
111 0.11
112 0.12
113 0.12
114 0.13
115 0.14
116 0.15
117 0.14
118 0.17
119 0.2
120 0.23
121 0.27
122 0.29
123 0.29
124 0.27
125 0.36
126 0.38
127 0.38
128 0.36
129 0.37
130 0.44
131 0.48
132 0.57
133 0.58
134 0.62
135 0.67
136 0.75
137 0.81
138 0.76
139 0.81
140 0.78
141 0.77
142 0.73
143 0.69
144 0.6
145 0.51
146 0.46
147 0.37
148 0.31
149 0.23
150 0.16
151 0.11
152 0.1
153 0.1
154 0.1
155 0.09
156 0.07
157 0.08
158 0.09
159 0.12
160 0.11
161 0.1
162 0.1
163 0.11
164 0.11
165 0.11
166 0.09
167 0.08
168 0.08
169 0.08
170 0.06
171 0.05
172 0.05
173 0.06
174 0.06
175 0.05
176 0.06
177 0.07
178 0.08
179 0.11
180 0.14
181 0.15
182 0.22
183 0.3
184 0.34
185 0.38
186 0.48
187 0.51
188 0.57
189 0.6
190 0.6
191 0.61
192 0.59
193 0.57
194 0.5
195 0.49
196 0.46
197 0.49
198 0.49
199 0.45
200 0.45
201 0.49
202 0.49
203 0.51
204 0.51
205 0.47
206 0.51
207 0.51
208 0.54
209 0.5
210 0.48
211 0.42
212 0.36
213 0.34
214 0.27
215 0.24
216 0.18
217 0.17
218 0.19
219 0.22
220 0.27
221 0.27
222 0.27
223 0.27
224 0.27
225 0.27
226 0.25
227 0.24
228 0.18
229 0.22
230 0.27
231 0.27
232 0.26
233 0.26
234 0.26
235 0.26
236 0.29
237 0.24
238 0.19
239 0.21
240 0.25
241 0.26
242 0.25
243 0.23
244 0.21
245 0.22
246 0.22
247 0.2
248 0.16
249 0.13
250 0.14
251 0.16
252 0.14
253 0.13
254 0.11
255 0.12
256 0.13
257 0.19
258 0.22
259 0.21
260 0.23
261 0.24
262 0.28
263 0.3
264 0.34
265 0.31
266 0.29
267 0.32
268 0.33
269 0.32
270 0.29
271 0.26
272 0.2
273 0.17
274 0.14
275 0.11
276 0.07
277 0.07
278 0.07
279 0.06
280 0.07
281 0.08
282 0.1
283 0.12
284 0.14
285 0.14
286 0.17
287 0.19
288 0.23
289 0.25
290 0.24
291 0.25
292 0.23
293 0.23
294 0.21
295 0.2
296 0.15
297 0.13
298 0.12
299 0.11
300 0.11
301 0.1
302 0.12
303 0.13
304 0.13
305 0.14
306 0.16
307 0.21
308 0.24
309 0.29
310 0.31
311 0.34
312 0.36
313 0.36
314 0.32
315 0.27
316 0.23
317 0.18
318 0.15
319 0.12
320 0.09
321 0.08
322 0.09
323 0.08
324 0.07
325 0.07
326 0.06
327 0.05
328 0.05
329 0.05
330 0.05
331 0.05
332 0.05
333 0.05
334 0.05
335 0.05
336 0.05
337 0.06
338 0.06
339 0.06
340 0.09
341 0.09
342 0.1
343 0.14
344 0.16
345 0.17
346 0.18
347 0.22
348 0.29
349 0.33
350 0.34
351 0.32
352 0.34