Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8X9G9

Protein Details
Accession L8X9G9    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-40MRSVSRSRSRGRSRSRSQSRAKSRSRSRSPTTHydrophilic
NLS Segment(s)
PositionSequence
14-36RSRSRGRSRSRSQSRAKSRSRSR
Subcellular Location(s) nucl 24, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0003723  F:RNA binding  
Pfam View protein in Pfam  
PF00076  RRM_1  
Amino Acid Sequences MAGDEDMRMRSVSRSRSRGRSRSRSQSRAKSRSRSRSPTTRTVFIKNLTRNIVQGHLRAVFSPYGDIRKIHIPGAVHTSSFSIRERPRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.51
3 0.61
4 0.7
5 0.75
6 0.79
7 0.8
8 0.8
9 0.83
10 0.86
11 0.84
12 0.84
13 0.85
14 0.85
15 0.84
16 0.83
17 0.82
18 0.82
19 0.83
20 0.83
21 0.8
22 0.76
23 0.76
24 0.75
25 0.75
26 0.69
27 0.65
28 0.59
29 0.55
30 0.51
31 0.45
32 0.46
33 0.38
34 0.37
35 0.34
36 0.32
37 0.28
38 0.26
39 0.27
40 0.22
41 0.2
42 0.19
43 0.17
44 0.17
45 0.16
46 0.17
47 0.13
48 0.12
49 0.13
50 0.13
51 0.14
52 0.15
53 0.16
54 0.17
55 0.22
56 0.23
57 0.22
58 0.23
59 0.21
60 0.22
61 0.28
62 0.27
63 0.21
64 0.2
65 0.21
66 0.2
67 0.21
68 0.21
69 0.23
70 0.3