Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RNA4

Protein Details
Accession E3RNA4    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
42-64QSANDAKAKQKSKKDQHLDNALVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR018860  APC_suCDC26  
Gene Ontology GO:0005680  C:anaphase-promoting complex  
GO:0031145  P:anaphase-promoting complex-dependent catabolic process  
GO:0030071  P:regulation of mitotic metaphase/anaphase transition  
KEGG pte:PTT_10044  -  
Pfam View protein in Pfam  
PF10471  ANAPC_CDC26  
Amino Acid Sequences MLRRAPTTITLTQTDIEQWEQDRKRKVHEVQQKLEDEQRNAQSANDAKAKQKSKKDQHLDNALV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.2
3 0.17
4 0.14
5 0.14
6 0.22
7 0.26
8 0.31
9 0.38
10 0.38
11 0.43
12 0.5
13 0.52
14 0.52
15 0.58
16 0.6
17 0.57
18 0.62
19 0.57
20 0.5
21 0.52
22 0.45
23 0.37
24 0.34
25 0.31
26 0.27
27 0.26
28 0.24
29 0.23
30 0.23
31 0.25
32 0.26
33 0.25
34 0.28
35 0.36
36 0.44
37 0.47
38 0.55
39 0.62
40 0.67
41 0.77
42 0.81
43 0.82
44 0.83