Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WU32

Protein Details
Accession L8WU32    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
44-67TSGGKAAKKKKWSKGKVKDKAQHABasic
NLS Segment(s)
PositionSequence
47-63GKAAKKKKWSKGKVKDK
Subcellular Location(s) mito 16, nucl 6, cyto_nucl 6, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MQICIPNWPSARQRSPNHHGEYTHNRERRRWPETFCYCRIIVSTSGGKAAKKKKWSKGKVKDKAQHAVTLNQATYDRIMKEVPTFKFISQSILIERLKIGGSLARVAIRHLAKEGQIKKIVHHNGQLIYTRATASD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.71
3 0.74
4 0.74
5 0.68
6 0.61
7 0.6
8 0.62
9 0.62
10 0.64
11 0.6
12 0.56
13 0.58
14 0.67
15 0.67
16 0.64
17 0.6
18 0.57
19 0.62
20 0.7
21 0.7
22 0.63
23 0.58
24 0.51
25 0.46
26 0.41
27 0.33
28 0.24
29 0.21
30 0.2
31 0.16
32 0.2
33 0.2
34 0.2
35 0.25
36 0.32
37 0.34
38 0.42
39 0.5
40 0.56
41 0.66
42 0.74
43 0.79
44 0.81
45 0.87
46 0.86
47 0.88
48 0.85
49 0.79
50 0.77
51 0.67
52 0.61
53 0.51
54 0.43
55 0.36
56 0.31
57 0.25
58 0.19
59 0.18
60 0.13
61 0.12
62 0.12
63 0.1
64 0.09
65 0.1
66 0.1
67 0.14
68 0.2
69 0.2
70 0.22
71 0.23
72 0.22
73 0.26
74 0.25
75 0.25
76 0.2
77 0.2
78 0.18
79 0.22
80 0.22
81 0.18
82 0.18
83 0.15
84 0.14
85 0.13
86 0.12
87 0.08
88 0.09
89 0.1
90 0.11
91 0.12
92 0.12
93 0.13
94 0.19
95 0.18
96 0.17
97 0.18
98 0.19
99 0.21
100 0.3
101 0.33
102 0.33
103 0.39
104 0.39
105 0.4
106 0.48
107 0.51
108 0.47
109 0.49
110 0.47
111 0.42
112 0.46
113 0.46
114 0.39
115 0.34
116 0.3