Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WUY5

Protein Details
Accession L8WUY5    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MGRRPARCYRYCKNKPYPKSRYNRGVPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18, nucl 4.5, cyto_nucl 4.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001197  Ribosomal_L10e  
IPR036920  Ribosomal_L10e/L16_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Amino Acid Sequences MGRRPARCYRYCKNKPYPKSRYNRGVPDPKASPSWIGFSLILLSNFLGIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.86
3 0.88
4 0.88
5 0.86
6 0.85
7 0.84
8 0.82
9 0.79
10 0.76
11 0.73
12 0.72
13 0.65
14 0.61
15 0.55
16 0.47
17 0.42
18 0.36
19 0.31
20 0.23
21 0.24
22 0.19
23 0.19
24 0.17
25 0.16
26 0.17
27 0.17
28 0.16
29 0.13
30 0.12