Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S3Z3

Protein Details
Accession E3S3Z3   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
124-145VGRVRCPMCRKGVKQRVRIHTGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 9, mito 8, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
KEGG pte:PTT_17246  -  
Pfam View protein in Pfam  
PF13920  zf-C3HC4_3  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
Amino Acid Sequences MQTSTEARLSNMLSLLTTSSQDPSSAIPPTTFPTDISSLRASIELELTRLRSARVRPPSPPPVTLDSQPDRPAPRSEEEMTKVLACQVCYQQIADIAVLPCGHMVMCVWCADVVVPVRHGSVPVGRVRCPMCRKGVKQRVRIHTG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.11
4 0.12
5 0.11
6 0.12
7 0.12
8 0.12
9 0.12
10 0.13
11 0.15
12 0.16
13 0.16
14 0.15
15 0.16
16 0.19
17 0.22
18 0.2
19 0.18
20 0.2
21 0.23
22 0.23
23 0.25
24 0.23
25 0.19
26 0.19
27 0.19
28 0.15
29 0.12
30 0.14
31 0.1
32 0.11
33 0.11
34 0.12
35 0.12
36 0.12
37 0.13
38 0.14
39 0.18
40 0.25
41 0.33
42 0.35
43 0.37
44 0.45
45 0.53
46 0.51
47 0.49
48 0.44
49 0.39
50 0.39
51 0.37
52 0.36
53 0.29
54 0.29
55 0.29
56 0.28
57 0.26
58 0.26
59 0.26
60 0.23
61 0.22
62 0.25
63 0.25
64 0.25
65 0.26
66 0.25
67 0.23
68 0.21
69 0.18
70 0.16
71 0.16
72 0.13
73 0.12
74 0.13
75 0.14
76 0.14
77 0.15
78 0.12
79 0.12
80 0.12
81 0.1
82 0.11
83 0.09
84 0.1
85 0.09
86 0.09
87 0.07
88 0.07
89 0.06
90 0.04
91 0.04
92 0.05
93 0.06
94 0.07
95 0.07
96 0.07
97 0.07
98 0.07
99 0.1
100 0.12
101 0.12
102 0.13
103 0.13
104 0.15
105 0.15
106 0.15
107 0.14
108 0.15
109 0.18
110 0.23
111 0.26
112 0.26
113 0.31
114 0.33
115 0.4
116 0.43
117 0.45
118 0.48
119 0.55
120 0.62
121 0.69
122 0.77
123 0.77
124 0.8
125 0.84