Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WNS4

Protein Details
Accession L8WNS4    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
4-25LHVPRRKRGTCGRRGMHKRWRGBasic
NLS Segment(s)
PositionSequence
7-29PRRKRGTCGRRGMHKRWRGGSAR
Subcellular Location(s) mito 15, nucl 9.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MGRLHVPRRKRGTCGRRGMHKRWRGGSARRHCTRVFHGTGGGGKQTLIETPTSPPLVLLIRPSFALSSRRYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.76
3 0.77
4 0.81
5 0.83
6 0.82
7 0.79
8 0.76
9 0.69
10 0.7
11 0.66
12 0.66
13 0.67
14 0.67
15 0.69
16 0.65
17 0.65
18 0.58
19 0.55
20 0.52
21 0.49
22 0.41
23 0.31
24 0.29
25 0.26
26 0.26
27 0.23
28 0.18
29 0.1
30 0.08
31 0.08
32 0.07
33 0.07
34 0.07
35 0.07
36 0.08
37 0.1
38 0.14
39 0.14
40 0.14
41 0.13
42 0.14
43 0.15
44 0.15
45 0.18
46 0.16
47 0.16
48 0.17
49 0.18
50 0.17
51 0.18
52 0.23