Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WPV5

Protein Details
Accession L8WPV5    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
20-51LYEPRTKIPPKPTRNKAKTKDGKKMREKQRGEBasic
NLS Segment(s)
PositionSequence
25-49TKIPPKPTRNKAKTKDGKKMREKQR
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MKISYSGERRIQSVLSGNTLYEPRTKIPPKPTRNKAKTKDGKKMREKQRGEEGDEAHWVDKEQQGIVDQHKDREMGDGKDNRME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.24
3 0.23
4 0.21
5 0.22
6 0.22
7 0.21
8 0.18
9 0.18
10 0.17
11 0.26
12 0.29
13 0.33
14 0.43
15 0.52
16 0.58
17 0.67
18 0.74
19 0.76
20 0.82
21 0.86
22 0.81
23 0.82
24 0.82
25 0.79
26 0.8
27 0.78
28 0.79
29 0.78
30 0.82
31 0.81
32 0.82
33 0.77
34 0.72
35 0.73
36 0.67
37 0.61
38 0.56
39 0.47
40 0.38
41 0.37
42 0.32
43 0.22
44 0.19
45 0.15
46 0.13
47 0.13
48 0.13
49 0.11
50 0.11
51 0.13
52 0.16
53 0.19
54 0.26
55 0.25
56 0.27
57 0.29
58 0.28
59 0.26
60 0.31
61 0.32
62 0.28
63 0.35
64 0.39