Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WNE6

Protein Details
Accession L8WNE6    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
129-153TQAPEPSKIPIRKKPWERTDQEEQVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13.833, mito_nucl 9.499, cyto 7.5
Family & Domain DBs
Pfam View protein in Pfam  
PF17733  DUF5572  
Amino Acid Sequences MATSPQDTEHVLKDFLAFPFHEDSAFLEGLQLLLGQPIVESLQRGGPITPELEQSLLGPKLFYYNRQHGTNLTPELVNEYTRAQPQTTAQPSTPDEDRQLSLAELTRLIETGQTHLIPHNYTIPDGVQTQAPEPSKIPIRKKPWERTDQEEQVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.21
3 0.21
4 0.16
5 0.17
6 0.2
7 0.2
8 0.18
9 0.15
10 0.17
11 0.18
12 0.18
13 0.15
14 0.11
15 0.11
16 0.11
17 0.1
18 0.08
19 0.04
20 0.04
21 0.04
22 0.04
23 0.03
24 0.04
25 0.05
26 0.05
27 0.06
28 0.06
29 0.08
30 0.09
31 0.1
32 0.1
33 0.1
34 0.11
35 0.11
36 0.11
37 0.11
38 0.11
39 0.1
40 0.1
41 0.1
42 0.13
43 0.12
44 0.11
45 0.1
46 0.09
47 0.14
48 0.15
49 0.2
50 0.22
51 0.29
52 0.33
53 0.35
54 0.35
55 0.32
56 0.34
57 0.33
58 0.27
59 0.2
60 0.16
61 0.14
62 0.17
63 0.16
64 0.14
65 0.1
66 0.11
67 0.12
68 0.13
69 0.15
70 0.11
71 0.12
72 0.13
73 0.21
74 0.22
75 0.23
76 0.21
77 0.24
78 0.25
79 0.27
80 0.27
81 0.2
82 0.19
83 0.19
84 0.19
85 0.17
86 0.16
87 0.13
88 0.13
89 0.13
90 0.11
91 0.09
92 0.1
93 0.09
94 0.08
95 0.08
96 0.09
97 0.08
98 0.1
99 0.12
100 0.11
101 0.12
102 0.14
103 0.16
104 0.14
105 0.15
106 0.19
107 0.17
108 0.17
109 0.18
110 0.16
111 0.16
112 0.16
113 0.16
114 0.13
115 0.13
116 0.14
117 0.19
118 0.2
119 0.2
120 0.2
121 0.25
122 0.32
123 0.39
124 0.46
125 0.49
126 0.57
127 0.66
128 0.75
129 0.81
130 0.82
131 0.84
132 0.82
133 0.8
134 0.82