Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WSA8

Protein Details
Accession L8WSA8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-25ASQHRPTKFAKNKHRLCLQTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19, cyto 4, plas 2
Family & Domain DBs
Amino Acid Sequences MIDAPASQHRPTKFAKNKHRLCLQTPVLPGSPWDSTAYSSFGDLPSRFPPLAQNVLPLYELIELFILLTGPAGFLPTHSPMIYTRNIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.63
3 0.69
4 0.75
5 0.79
6 0.83
7 0.76
8 0.71
9 0.7
10 0.63
11 0.58
12 0.51
13 0.46
14 0.38
15 0.33
16 0.3
17 0.23
18 0.19
19 0.15
20 0.15
21 0.13
22 0.13
23 0.14
24 0.16
25 0.12
26 0.12
27 0.11
28 0.1
29 0.12
30 0.11
31 0.13
32 0.12
33 0.15
34 0.14
35 0.14
36 0.16
37 0.18
38 0.22
39 0.19
40 0.21
41 0.18
42 0.19
43 0.19
44 0.16
45 0.13
46 0.1
47 0.09
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.05
54 0.03
55 0.04
56 0.03
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.1
63 0.13
64 0.15
65 0.15
66 0.17
67 0.17
68 0.22