Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WMF3

Protein Details
Accession L8WMF3   
Localization Confidence Low
Confidence Score 6.8
NoLS Segment(s)
PositionSequenceProtein Nature
164-184LPPAPPFKRWAPKKQEDAPHDHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto_nucl 7.5, cyto 7, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR016813  NADH_Ub_cplx-1_21kDa_fun  
CDD cd22849  NuzM  
Amino Acid Sequences MATKQAVGKFADHTKYHLAFGRNSVGPDLLSNLDVCILTSRGLGDAVVVNPEISSGIPLVTAHRWPQPGSRPEIYATPATKASDPAQNPYWKRDARRHYPQLSVVTQSHLSQVLLGAPSAEAVAAPADDKSSVPANVSPPAPLELTEAIAKAANSTKAFSSTNLPPAPPFKRWAPKKQEDAPHDPTAYWPMSLYGGSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.39
3 0.4
4 0.41
5 0.37
6 0.33
7 0.36
8 0.39
9 0.32
10 0.32
11 0.3
12 0.25
13 0.22
14 0.2
15 0.19
16 0.13
17 0.12
18 0.11
19 0.1
20 0.1
21 0.1
22 0.1
23 0.09
24 0.09
25 0.09
26 0.09
27 0.09
28 0.09
29 0.09
30 0.08
31 0.07
32 0.08
33 0.08
34 0.08
35 0.08
36 0.08
37 0.07
38 0.07
39 0.07
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.07
47 0.09
48 0.11
49 0.12
50 0.16
51 0.17
52 0.18
53 0.24
54 0.3
55 0.33
56 0.38
57 0.37
58 0.35
59 0.34
60 0.35
61 0.32
62 0.27
63 0.24
64 0.19
65 0.19
66 0.18
67 0.18
68 0.18
69 0.18
70 0.19
71 0.19
72 0.21
73 0.25
74 0.29
75 0.3
76 0.31
77 0.37
78 0.33
79 0.37
80 0.42
81 0.45
82 0.48
83 0.57
84 0.62
85 0.58
86 0.58
87 0.57
88 0.53
89 0.46
90 0.4
91 0.3
92 0.25
93 0.22
94 0.2
95 0.17
96 0.13
97 0.12
98 0.08
99 0.08
100 0.07
101 0.07
102 0.06
103 0.05
104 0.04
105 0.05
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.04
115 0.04
116 0.05
117 0.06
118 0.09
119 0.09
120 0.1
121 0.12
122 0.14
123 0.16
124 0.17
125 0.15
126 0.14
127 0.16
128 0.15
129 0.13
130 0.14
131 0.11
132 0.13
133 0.13
134 0.12
135 0.11
136 0.12
137 0.11
138 0.1
139 0.12
140 0.14
141 0.15
142 0.16
143 0.16
144 0.19
145 0.2
146 0.2
147 0.23
148 0.23
149 0.3
150 0.3
151 0.29
152 0.29
153 0.35
154 0.38
155 0.36
156 0.36
157 0.37
158 0.47
159 0.55
160 0.63
161 0.66
162 0.7
163 0.77
164 0.81
165 0.82
166 0.79
167 0.79
168 0.76
169 0.72
170 0.63
171 0.54
172 0.47
173 0.43
174 0.37
175 0.28
176 0.21
177 0.17
178 0.17