Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WID9

Protein Details
Accession L8WID9    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
5-27LLTNLRSRRSPKNTTRPQVRSSFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 20, nucl 5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018170  Aldo/ket_reductase_CS  
IPR036812  NADP_OxRdtase_dom_sf  
Gene Ontology GO:0016491  F:oxidoreductase activity  
PROSITE View protein in PROSITE  
PS00063  ALDOKETO_REDUCTASE_3  
Amino Acid Sequences MKVALLTNLRSRRSPKNTTRPQVRSSFPGVSRDHDLVILPKSVNAKRIAENVGIFDYDAEDTAAIDGINLNLRYNDASTDFGYVFFSDEKSPAKIADAFLELSKSAVAKAKATWLIATNARPNEPPWVSITCPVQSRTRPSRSDRHAHLALPIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.66
3 0.7
4 0.78
5 0.84
6 0.89
7 0.84
8 0.82
9 0.78
10 0.7
11 0.64
12 0.59
13 0.56
14 0.48
15 0.48
16 0.43
17 0.41
18 0.42
19 0.38
20 0.32
21 0.26
22 0.24
23 0.2
24 0.2
25 0.18
26 0.14
27 0.15
28 0.2
29 0.21
30 0.24
31 0.25
32 0.26
33 0.26
34 0.3
35 0.31
36 0.27
37 0.26
38 0.23
39 0.2
40 0.17
41 0.15
42 0.11
43 0.09
44 0.07
45 0.07
46 0.05
47 0.04
48 0.04
49 0.04
50 0.05
51 0.03
52 0.03
53 0.03
54 0.03
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.07
62 0.08
63 0.07
64 0.08
65 0.08
66 0.1
67 0.1
68 0.09
69 0.1
70 0.09
71 0.09
72 0.07
73 0.08
74 0.07
75 0.09
76 0.1
77 0.11
78 0.11
79 0.1
80 0.12
81 0.12
82 0.12
83 0.13
84 0.13
85 0.12
86 0.12
87 0.12
88 0.1
89 0.09
90 0.09
91 0.07
92 0.07
93 0.1
94 0.11
95 0.12
96 0.12
97 0.17
98 0.19
99 0.19
100 0.19
101 0.17
102 0.2
103 0.22
104 0.24
105 0.25
106 0.25
107 0.27
108 0.27
109 0.26
110 0.31
111 0.29
112 0.27
113 0.24
114 0.26
115 0.26
116 0.3
117 0.32
118 0.27
119 0.3
120 0.31
121 0.34
122 0.36
123 0.44
124 0.49
125 0.53
126 0.56
127 0.59
128 0.67
129 0.69
130 0.73
131 0.7
132 0.7
133 0.65
134 0.59