Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WNP7

Protein Details
Accession L8WNP7    Localization Confidence Low Confidence Score 6.5
NoLS Segment(s)
PositionSequenceProtein Nature
72-95GLIKKQPPRARPVCRLCRRHCITTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, plas 6, cyto_mito 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR041752  Coa3  
IPR018628  Coa3_cc  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
Pfam View protein in Pfam  
PF09813  Coa3_cc  
Amino Acid Sequences MSTSKASANASYRPQGYGMSPALKRARQPFAVRNALTGSAIAAFAVGVWAYSISAVKQDNFDDIDAEANAAGLIKKQPPRARPVCRLCRRHCITTTPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.25
4 0.25
5 0.23
6 0.25
7 0.24
8 0.29
9 0.33
10 0.34
11 0.37
12 0.38
13 0.41
14 0.41
15 0.47
16 0.47
17 0.5
18 0.56
19 0.51
20 0.46
21 0.41
22 0.35
23 0.3
24 0.23
25 0.15
26 0.07
27 0.07
28 0.06
29 0.04
30 0.03
31 0.03
32 0.03
33 0.02
34 0.02
35 0.02
36 0.02
37 0.02
38 0.03
39 0.03
40 0.03
41 0.05
42 0.06
43 0.07
44 0.08
45 0.09
46 0.1
47 0.11
48 0.11
49 0.1
50 0.09
51 0.1
52 0.09
53 0.08
54 0.07
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.07
61 0.13
62 0.18
63 0.26
64 0.33
65 0.37
66 0.47
67 0.56
68 0.63
69 0.68
70 0.74
71 0.77
72 0.81
73 0.86
74 0.83
75 0.84
76 0.82
77 0.79
78 0.73