Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S5M9

Protein Details
Accession E3S5M9   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
118-149RMDKLNKEKIERRRLKRQKKKEKRAETTAVTTBasic
NLS Segment(s)
PositionSequence
122-142LNKEKIERRRLKRQKKKEKRA
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
KEGG pte:PTT_17951  -  
Amino Acid Sequences MNCGAETEGCSLSCEKTTPAAATSDAVSSDTPITVPATPARKLTNQLKEVLNKKGTKSVGEQPQHKEVRDAAKIDTKAKVHKATDNKAKLRADCGADSGTIYNNVPAMVYYTTEQRERMDKLNKEKIERRRLKRQKKKEKRAETTAVTTQKLGSATKKKEKLNLQTKLLLLKLHVMK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.17
4 0.2
5 0.19
6 0.19
7 0.19
8 0.18
9 0.18
10 0.17
11 0.15
12 0.13
13 0.12
14 0.11
15 0.11
16 0.1
17 0.09
18 0.08
19 0.09
20 0.1
21 0.09
22 0.11
23 0.15
24 0.19
25 0.2
26 0.22
27 0.25
28 0.26
29 0.32
30 0.39
31 0.44
32 0.42
33 0.45
34 0.46
35 0.5
36 0.51
37 0.52
38 0.5
39 0.43
40 0.42
41 0.44
42 0.41
43 0.36
44 0.37
45 0.38
46 0.41
47 0.44
48 0.48
49 0.45
50 0.54
51 0.54
52 0.49
53 0.42
54 0.36
55 0.37
56 0.35
57 0.32
58 0.25
59 0.28
60 0.3
61 0.3
62 0.3
63 0.25
64 0.26
65 0.29
66 0.32
67 0.28
68 0.32
69 0.37
70 0.4
71 0.48
72 0.51
73 0.49
74 0.5
75 0.5
76 0.45
77 0.41
78 0.36
79 0.29
80 0.22
81 0.22
82 0.16
83 0.14
84 0.14
85 0.12
86 0.09
87 0.08
88 0.08
89 0.07
90 0.06
91 0.06
92 0.06
93 0.05
94 0.07
95 0.06
96 0.07
97 0.08
98 0.11
99 0.13
100 0.14
101 0.15
102 0.15
103 0.19
104 0.21
105 0.27
106 0.33
107 0.37
108 0.45
109 0.54
110 0.55
111 0.58
112 0.63
113 0.66
114 0.68
115 0.72
116 0.71
117 0.73
118 0.81
119 0.86
120 0.89
121 0.91
122 0.91
123 0.92
124 0.96
125 0.96
126 0.96
127 0.93
128 0.91
129 0.87
130 0.8
131 0.75
132 0.71
133 0.65
134 0.54
135 0.46
136 0.38
137 0.33
138 0.29
139 0.25
140 0.26
141 0.32
142 0.4
143 0.49
144 0.56
145 0.58
146 0.64
147 0.71
148 0.74
149 0.74
150 0.74
151 0.69
152 0.67
153 0.65
154 0.61
155 0.53
156 0.43
157 0.33