Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WNC8

Protein Details
Accession L8WNC8   
Localization Confidence Medium
Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
45-77EVCVWRSGSRSRRRRSRRRKKEEQQGHCWRRARBasic
NLS Segment(s)
PositionSequence
53-69SRSRRRRSRRRKKEEQQ
73-80WRRARTRK
Subcellular Location(s) nucl 12, mito 11, cyto 3
Family & Domain DBs
Amino Acid Sequences MLIKHDYIGGCRQQARLRRSGDGAHRAERHPGPADRGHGIGSSVEVCVWRSGSRSRRRRSRRRKKEEQQGHCWRRARTRKM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.47
3 0.48
4 0.47
5 0.46
6 0.46
7 0.48
8 0.49
9 0.5
10 0.47
11 0.46
12 0.45
13 0.43
14 0.46
15 0.41
16 0.37
17 0.33
18 0.3
19 0.28
20 0.28
21 0.3
22 0.25
23 0.25
24 0.22
25 0.17
26 0.16
27 0.12
28 0.09
29 0.07
30 0.06
31 0.05
32 0.05
33 0.06
34 0.06
35 0.07
36 0.07
37 0.09
38 0.17
39 0.26
40 0.36
41 0.45
42 0.54
43 0.64
44 0.75
45 0.84
46 0.88
47 0.91
48 0.92
49 0.93
50 0.95
51 0.94
52 0.95
53 0.94
54 0.92
55 0.91
56 0.91
57 0.88
58 0.84
59 0.8
60 0.74
61 0.74