Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S376

Protein Details
Accession E3S376    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
66-91EIVSKSPSKSRTKKRNTSPSKNGVKSHydrophilic
NLS Segment(s)
PositionSequence
70-108KSPSKSRTKKRNTSPSKNGVKSGRVSKSRNKTTTRTKVK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 6, cyto 3.5
Family & Domain DBs
KEGG pte:PTT_16888  -  
Amino Acid Sequences MVIQWNNTQVVERLFIAMLASVNNKINISEVAHIYGEPMTYNALETRLRKWKQEATVMKTAAAGREIVSKSPSKSRTKKRNTSPSKNGVKSGRVSKSRNKTTTRTKVKAEPIIKGKDELEEDSDIEDDGEEDFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.12
5 0.1
6 0.09
7 0.1
8 0.11
9 0.12
10 0.13
11 0.13
12 0.12
13 0.14
14 0.14
15 0.14
16 0.15
17 0.14
18 0.15
19 0.15
20 0.14
21 0.14
22 0.12
23 0.1
24 0.08
25 0.07
26 0.06
27 0.06
28 0.07
29 0.07
30 0.09
31 0.12
32 0.13
33 0.18
34 0.27
35 0.29
36 0.31
37 0.35
38 0.39
39 0.41
40 0.49
41 0.5
42 0.47
43 0.52
44 0.49
45 0.44
46 0.39
47 0.35
48 0.26
49 0.2
50 0.13
51 0.07
52 0.12
53 0.12
54 0.11
55 0.13
56 0.14
57 0.15
58 0.22
59 0.28
60 0.32
61 0.41
62 0.51
63 0.6
64 0.69
65 0.77
66 0.8
67 0.85
68 0.86
69 0.87
70 0.85
71 0.85
72 0.84
73 0.76
74 0.72
75 0.64
76 0.58
77 0.53
78 0.52
79 0.5
80 0.47
81 0.5
82 0.54
83 0.61
84 0.67
85 0.69
86 0.66
87 0.66
88 0.7
89 0.77
90 0.78
91 0.72
92 0.68
93 0.69
94 0.71
95 0.73
96 0.65
97 0.62
98 0.59
99 0.6
100 0.56
101 0.5
102 0.43
103 0.37
104 0.37
105 0.31
106 0.27
107 0.23
108 0.22
109 0.21
110 0.2
111 0.16
112 0.14
113 0.11
114 0.08