Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S2X8

Protein Details
Accession E3S2X8    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
111-137AEQTPSKKPRARKPKTPSKKAKSAAEAHydrophilic
NLS Segment(s)
PositionSequence
87-94KTPSKKKT
116-133SKKPRARKPKTPSKKAKS
Subcellular Location(s) nucl 21, cyto_nucl 13, cyto 3
Family & Domain DBs
KEGG pte:PTT_16729  -  
Amino Acid Sequences MASRKAIAANGDAGEGPFKWEGPNDNKAAMLSRTSMSRPDEYEQLTTAFPGTTTGSIHNRISALRVKQRDFYESMGWTLPEGGATKKTPSKKKTPIKRDAEDAGVDDAEEAEQTPSKKPRARKPKTPSKKAKSAAEAEEGSESEGKKVKDEAGDEEDM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.13
4 0.11
5 0.11
6 0.11
7 0.13
8 0.2
9 0.25
10 0.31
11 0.3
12 0.3
13 0.31
14 0.3
15 0.31
16 0.25
17 0.2
18 0.16
19 0.15
20 0.16
21 0.17
22 0.21
23 0.21
24 0.23
25 0.24
26 0.25
27 0.28
28 0.28
29 0.28
30 0.25
31 0.23
32 0.2
33 0.17
34 0.15
35 0.11
36 0.08
37 0.08
38 0.08
39 0.08
40 0.08
41 0.12
42 0.14
43 0.17
44 0.18
45 0.17
46 0.17
47 0.16
48 0.18
49 0.2
50 0.22
51 0.26
52 0.3
53 0.31
54 0.36
55 0.37
56 0.37
57 0.34
58 0.31
59 0.28
60 0.24
61 0.23
62 0.18
63 0.16
64 0.13
65 0.11
66 0.08
67 0.06
68 0.06
69 0.06
70 0.08
71 0.09
72 0.11
73 0.16
74 0.23
75 0.31
76 0.36
77 0.45
78 0.53
79 0.62
80 0.7
81 0.76
82 0.79
83 0.8
84 0.77
85 0.72
86 0.64
87 0.57
88 0.47
89 0.37
90 0.28
91 0.19
92 0.16
93 0.11
94 0.09
95 0.06
96 0.05
97 0.05
98 0.04
99 0.07
100 0.08
101 0.14
102 0.19
103 0.26
104 0.31
105 0.39
106 0.49
107 0.59
108 0.66
109 0.72
110 0.77
111 0.82
112 0.88
113 0.91
114 0.91
115 0.89
116 0.9
117 0.86
118 0.84
119 0.8
120 0.75
121 0.67
122 0.62
123 0.53
124 0.44
125 0.39
126 0.31
127 0.25
128 0.22
129 0.18
130 0.16
131 0.2
132 0.19
133 0.2
134 0.22
135 0.24
136 0.26
137 0.29
138 0.32