Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8X917

Protein Details
Accession L8X917   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
22-46LGLVLFAHRRKRQRRERGRVVLGRLHydrophilic
NLS Segment(s)
PositionSequence
30-60RRKRQRRERGRVVLGRLALPRQLGEKRGTGR
Subcellular Location(s) extr 12, plas 6, vacu 4, E.R. 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFRFGGPASRSRLTGTLISLVLGLVLFAHRRKRQRRERGRVVLGRLALPRQLGEKRGTGRAGAQRDSRFSFGLGRRARVGDPGSERVQFRVLAGDRDTARLGFRAREALFGFRIGQASADGVDGIGRIVGRSAERHVLGRFGKGTTEQEEIAVVGILDRRTLYAHASMAVEAAAAVAAAAGLVAGNAAAAAAVHWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.23
4 0.21
5 0.21
6 0.18
7 0.15
8 0.12
9 0.09
10 0.07
11 0.04
12 0.05
13 0.07
14 0.11
15 0.2
16 0.26
17 0.37
18 0.47
19 0.58
20 0.68
21 0.77
22 0.85
23 0.87
24 0.92
25 0.92
26 0.91
27 0.86
28 0.79
29 0.72
30 0.62
31 0.54
32 0.45
33 0.36
34 0.28
35 0.23
36 0.18
37 0.19
38 0.2
39 0.2
40 0.21
41 0.25
42 0.27
43 0.3
44 0.3
45 0.26
46 0.29
47 0.33
48 0.34
49 0.33
50 0.35
51 0.33
52 0.36
53 0.38
54 0.34
55 0.28
56 0.24
57 0.28
58 0.25
59 0.32
60 0.3
61 0.29
62 0.29
63 0.3
64 0.3
65 0.26
66 0.25
67 0.2
68 0.22
69 0.24
70 0.25
71 0.26
72 0.25
73 0.23
74 0.23
75 0.19
76 0.15
77 0.17
78 0.15
79 0.15
80 0.15
81 0.18
82 0.16
83 0.18
84 0.18
85 0.12
86 0.12
87 0.12
88 0.12
89 0.1
90 0.1
91 0.14
92 0.14
93 0.16
94 0.17
95 0.17
96 0.16
97 0.16
98 0.16
99 0.12
100 0.12
101 0.1
102 0.09
103 0.07
104 0.07
105 0.06
106 0.06
107 0.05
108 0.04
109 0.04
110 0.04
111 0.03
112 0.04
113 0.03
114 0.03
115 0.04
116 0.05
117 0.06
118 0.07
119 0.1
120 0.13
121 0.14
122 0.16
123 0.16
124 0.21
125 0.21
126 0.22
127 0.21
128 0.18
129 0.19
130 0.18
131 0.21
132 0.19
133 0.2
134 0.18
135 0.17
136 0.16
137 0.15
138 0.13
139 0.1
140 0.07
141 0.05
142 0.07
143 0.07
144 0.07
145 0.07
146 0.08
147 0.09
148 0.1
149 0.12
150 0.12
151 0.13
152 0.14
153 0.15
154 0.14
155 0.13
156 0.12
157 0.09
158 0.06
159 0.06
160 0.04
161 0.03
162 0.03
163 0.02
164 0.02
165 0.02
166 0.02
167 0.02
168 0.02
169 0.02
170 0.02
171 0.02
172 0.02
173 0.02
174 0.02
175 0.02
176 0.02