Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WQB1

Protein Details
Accession L8WQB1    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
12-42LRQLKYSRSKVNRQSKTKRKCAKARMCVYNSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, mito_nucl 14.5, nucl 11
Family & Domain DBs
Amino Acid Sequences MNRQSVYMCVHLRQLKYSRSKVNRQSKTKRKCAKARMCVYNSELWREQASVQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.47
4 0.52
5 0.55
6 0.57
7 0.65
8 0.68
9 0.74
10 0.75
11 0.77
12 0.81
13 0.82
14 0.84
15 0.85
16 0.84
17 0.83
18 0.83
19 0.84
20 0.84
21 0.84
22 0.84
23 0.83
24 0.77
25 0.71
26 0.65
27 0.62
28 0.53
29 0.49
30 0.42
31 0.35
32 0.34