Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WFG5

Protein Details
Accession L8WFG5    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
11-36SCDTSWCKRRLTRKLPHTRRAPPSPRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MEGSAGSSGSSCDTSWCKRRLTRKLPHTRRAPPSPRATLIESPAQTSTLGRTFTTMGSVSNTSASTTSFGRSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.32
3 0.36
4 0.4
5 0.45
6 0.56
7 0.63
8 0.68
9 0.71
10 0.74
11 0.81
12 0.85
13 0.87
14 0.85
15 0.83
16 0.81
17 0.81
18 0.76
19 0.72
20 0.7
21 0.64
22 0.58
23 0.52
24 0.48
25 0.39
26 0.35
27 0.33
28 0.26
29 0.24
30 0.22
31 0.19
32 0.16
33 0.14
34 0.14
35 0.13
36 0.14
37 0.12
38 0.14
39 0.14
40 0.14
41 0.16
42 0.14
43 0.11
44 0.13
45 0.14
46 0.14
47 0.14
48 0.14
49 0.13
50 0.13
51 0.13
52 0.12
53 0.12