Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L8WM83

Protein Details
Accession L8WM83    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
65-87GSPAAPKKPKKVKAPKQKAVKVEHydrophilic
NLS Segment(s)
PositionSequence
69-83APKKPKKVKAPKQKA
Subcellular Location(s) mito 23, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MQYRSRAVAPASPSMTSSVRSSASSSVHSDDGASSSSLVYHSEEEQEDLGDPNVLAHELCDFFGGSPAAPKKPKKVKAPKQKAVKVELPVDATATGAQTRESTSRLRRLCKAIVPGSKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.25
4 0.23
5 0.19
6 0.18
7 0.19
8 0.2
9 0.2
10 0.21
11 0.21
12 0.22
13 0.22
14 0.21
15 0.19
16 0.18
17 0.15
18 0.14
19 0.12
20 0.1
21 0.08
22 0.07
23 0.07
24 0.07
25 0.08
26 0.08
27 0.08
28 0.09
29 0.1
30 0.11
31 0.11
32 0.11
33 0.1
34 0.1
35 0.09
36 0.08
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.04
43 0.03
44 0.04
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.07
51 0.07
52 0.05
53 0.09
54 0.11
55 0.15
56 0.2
57 0.22
58 0.3
59 0.4
60 0.48
61 0.55
62 0.65
63 0.72
64 0.78
65 0.87
66 0.86
67 0.87
68 0.85
69 0.79
70 0.74
71 0.69
72 0.62
73 0.53
74 0.47
75 0.39
76 0.33
77 0.29
78 0.22
79 0.17
80 0.13
81 0.11
82 0.09
83 0.07
84 0.08
85 0.08
86 0.11
87 0.12
88 0.14
89 0.2
90 0.27
91 0.36
92 0.42
93 0.47
94 0.51
95 0.56
96 0.59
97 0.59
98 0.61
99 0.6