Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L8WTS8

Protein Details
Accession L8WTS8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
131-156LKNWLRSAKKAERLRKRAGRSKKVNGHydrophilic
NLS Segment(s)
PositionSequence
118-156RRSVRGYEQKRHVLKNWLRSAKKAERLRKRAGRSKKVNG
Subcellular Location(s) nucl 13, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR005579  Cgr1-like  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF03879  Cgr1  
Amino Acid Sequences MTTPVIPMSPAQPVEAATHTEEADFVPLAQTSNGRASGKGWKSQKTATKYVSRFKFSVAPDPWECMRRRSHMQAGVRAKSWEARMRKTAAETAVKRLHKEMIEEKAAEAARVGDEKFRRSVRGYEQKRHVLKNWLRSAKKAERLRKRAGRSKKVNG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.17
5 0.18
6 0.17
7 0.16
8 0.15
9 0.12
10 0.13
11 0.1
12 0.08
13 0.07
14 0.08
15 0.08
16 0.09
17 0.09
18 0.1
19 0.13
20 0.17
21 0.16
22 0.16
23 0.18
24 0.27
25 0.29
26 0.34
27 0.36
28 0.38
29 0.41
30 0.48
31 0.53
32 0.5
33 0.54
34 0.52
35 0.57
36 0.55
37 0.6
38 0.6
39 0.56
40 0.5
41 0.45
42 0.46
43 0.38
44 0.44
45 0.37
46 0.37
47 0.33
48 0.36
49 0.35
50 0.34
51 0.33
52 0.28
53 0.3
54 0.29
55 0.34
56 0.36
57 0.41
58 0.42
59 0.44
60 0.48
61 0.5
62 0.47
63 0.42
64 0.37
65 0.31
66 0.27
67 0.26
68 0.25
69 0.23
70 0.24
71 0.27
72 0.29
73 0.3
74 0.29
75 0.29
76 0.25
77 0.3
78 0.27
79 0.31
80 0.36
81 0.36
82 0.35
83 0.33
84 0.33
85 0.27
86 0.3
87 0.28
88 0.27
89 0.28
90 0.28
91 0.26
92 0.27
93 0.26
94 0.22
95 0.17
96 0.12
97 0.1
98 0.11
99 0.12
100 0.13
101 0.15
102 0.18
103 0.23
104 0.24
105 0.27
106 0.28
107 0.34
108 0.38
109 0.47
110 0.52
111 0.56
112 0.63
113 0.69
114 0.72
115 0.71
116 0.65
117 0.65
118 0.64
119 0.65
120 0.67
121 0.68
122 0.64
123 0.64
124 0.68
125 0.67
126 0.71
127 0.7
128 0.7
129 0.72
130 0.78
131 0.84
132 0.84
133 0.84
134 0.85
135 0.86
136 0.87