Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3RQN6

Protein Details
Accession E3RQN6    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
44-81GMKREERVKEKERKEKERKEKERKEKERKEKEKAAKATBasic
NLS Segment(s)
PositionSequence
28-81TKELKAKPKLITEEQAGMKREERVKEKERKEKERKEKERKEKERKEKEKAAKAT
Subcellular Location(s) nucl 25
Family & Domain DBs
KEGG pte:PTT_11053  -  
Amino Acid Sequences MDEKGFHLGRGEENKREIEEDKRNQLRTKELKAKPKLITEEQAGMKREERVKEKERKEKERKEKERKEKERKEKEKAAKAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.37
3 0.39
4 0.35
5 0.34
6 0.39
7 0.41
8 0.48
9 0.52
10 0.54
11 0.56
12 0.55
13 0.57
14 0.54
15 0.56
16 0.57
17 0.57
18 0.63
19 0.65
20 0.7
21 0.63
22 0.61
23 0.57
24 0.49
25 0.45
26 0.37
27 0.36
28 0.32
29 0.32
30 0.29
31 0.25
32 0.23
33 0.25
34 0.27
35 0.27
36 0.3
37 0.34
38 0.42
39 0.5
40 0.58
41 0.64
42 0.7
43 0.76
44 0.81
45 0.84
46 0.87
47 0.89
48 0.91
49 0.92
50 0.94
51 0.94
52 0.95
53 0.95
54 0.95
55 0.94
56 0.95
57 0.95
58 0.93
59 0.92
60 0.91
61 0.9