Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PEB6

Protein Details
Accession A0A1D8PEB6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
307-346IERRENERVRNLRRLKRENMRRDYDDHSRRRQAGKRRYDEBasic
NLS Segment(s)
PositionSequence
320-322RLK
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR006939  SNF5  
Gene Ontology GO:0000228  C:nuclear chromosome  
GO:0005634  C:nucleus  
GO:0016586  C:RSC-type complex  
GO:0003712  F:transcription coregulator activity  
GO:0006338  P:chromatin remodeling  
GO:0031055  P:chromatin remodeling at centromere  
GO:0007059  P:chromosome segregation  
GO:0006302  P:double-strand break repair  
GO:0000086  P:G2/M transition of mitotic cell cycle  
GO:0006337  P:nucleosome disassembly  
GO:1900461  P:positive regulation of pseudohyphal growth by positive regulation of transcription from RNA polymerase II promoter  
GO:0033262  P:regulation of nuclear cell cycle DNA replication  
GO:0006368  P:transcription elongation by RNA polymerase II  
KEGG cal:CAALFM_C108160WA  -  
Pfam View protein in Pfam  
PF04855  SNF5  
Amino Acid Sequences MATSQELTADIQALATSFPKRLANDSDNSLLINVAPTGRQAKRHIQQINYSEEFGDDLDFDEFPSSTPGTRSLNENKAQIEAQRYSLAKNTPTPKRILEKPVLSELVEKPVVLIPIKIMIENLNTNQKLIDSFMWNLNESLITPTEFAEIVCSDLDLPFSMAAQIADSINQQIEEYSYASNLQLPNKGPYNVTIDLSVNLNKQLYQDRFEWDMNQNEVTPEIFAEIVVADLGLSLEFKNAISHALHEIIIRVKKEVIDGTFNNEMHNLHLVKGIMFEQGIRIFTENSVQNGNDRWEPLVEVLTSSEIERRENERVRNLRRLKRENMRRDYDDHSRRRQAGKRRYDELEGAWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.11
3 0.12
4 0.11
5 0.15
6 0.19
7 0.21
8 0.26
9 0.33
10 0.36
11 0.38
12 0.42
13 0.42
14 0.38
15 0.37
16 0.31
17 0.23
18 0.18
19 0.15
20 0.1
21 0.08
22 0.08
23 0.1
24 0.18
25 0.2
26 0.26
27 0.31
28 0.4
29 0.46
30 0.55
31 0.59
32 0.56
33 0.62
34 0.61
35 0.64
36 0.56
37 0.5
38 0.41
39 0.35
40 0.3
41 0.22
42 0.17
43 0.09
44 0.08
45 0.09
46 0.08
47 0.08
48 0.09
49 0.09
50 0.09
51 0.11
52 0.11
53 0.11
54 0.12
55 0.16
56 0.18
57 0.19
58 0.25
59 0.31
60 0.37
61 0.4
62 0.42
63 0.38
64 0.37
65 0.37
66 0.33
67 0.31
68 0.25
69 0.24
70 0.26
71 0.26
72 0.25
73 0.28
74 0.28
75 0.25
76 0.31
77 0.37
78 0.4
79 0.42
80 0.44
81 0.45
82 0.48
83 0.52
84 0.52
85 0.52
86 0.48
87 0.48
88 0.5
89 0.45
90 0.39
91 0.37
92 0.3
93 0.28
94 0.24
95 0.2
96 0.16
97 0.17
98 0.18
99 0.14
100 0.13
101 0.09
102 0.12
103 0.13
104 0.12
105 0.11
106 0.1
107 0.12
108 0.14
109 0.15
110 0.19
111 0.19
112 0.19
113 0.18
114 0.18
115 0.16
116 0.16
117 0.16
118 0.11
119 0.13
120 0.16
121 0.17
122 0.18
123 0.17
124 0.15
125 0.13
126 0.11
127 0.11
128 0.09
129 0.08
130 0.08
131 0.08
132 0.09
133 0.08
134 0.08
135 0.08
136 0.07
137 0.07
138 0.07
139 0.07
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.04
146 0.04
147 0.05
148 0.04
149 0.04
150 0.04
151 0.05
152 0.04
153 0.05
154 0.05
155 0.05
156 0.05
157 0.05
158 0.05
159 0.04
160 0.05
161 0.05
162 0.06
163 0.06
164 0.06
165 0.06
166 0.06
167 0.09
168 0.1
169 0.1
170 0.13
171 0.14
172 0.17
173 0.18
174 0.19
175 0.17
176 0.18
177 0.22
178 0.2
179 0.19
180 0.18
181 0.16
182 0.16
183 0.17
184 0.16
185 0.11
186 0.11
187 0.1
188 0.09
189 0.11
190 0.17
191 0.17
192 0.19
193 0.2
194 0.22
195 0.26
196 0.26
197 0.28
198 0.25
199 0.26
200 0.24
201 0.24
202 0.21
203 0.17
204 0.17
205 0.14
206 0.1
207 0.07
208 0.06
209 0.05
210 0.05
211 0.05
212 0.04
213 0.04
214 0.04
215 0.03
216 0.02
217 0.03
218 0.03
219 0.02
220 0.03
221 0.03
222 0.04
223 0.04
224 0.04
225 0.05
226 0.05
227 0.07
228 0.07
229 0.09
230 0.1
231 0.11
232 0.12
233 0.11
234 0.13
235 0.16
236 0.19
237 0.18
238 0.17
239 0.17
240 0.17
241 0.19
242 0.2
243 0.18
244 0.21
245 0.2
246 0.25
247 0.3
248 0.29
249 0.28
250 0.26
251 0.23
252 0.19
253 0.24
254 0.19
255 0.14
256 0.16
257 0.16
258 0.15
259 0.16
260 0.15
261 0.11
262 0.11
263 0.1
264 0.1
265 0.12
266 0.13
267 0.12
268 0.13
269 0.13
270 0.13
271 0.19
272 0.18
273 0.18
274 0.2
275 0.19
276 0.2
277 0.22
278 0.25
279 0.21
280 0.2
281 0.2
282 0.18
283 0.19
284 0.18
285 0.18
286 0.14
287 0.13
288 0.12
289 0.12
290 0.12
291 0.12
292 0.14
293 0.13
294 0.15
295 0.18
296 0.23
297 0.31
298 0.37
299 0.43
300 0.5
301 0.58
302 0.64
303 0.71
304 0.75
305 0.75
306 0.79
307 0.81
308 0.81
309 0.82
310 0.85
311 0.86
312 0.85
313 0.85
314 0.78
315 0.75
316 0.72
317 0.72
318 0.71
319 0.69
320 0.69
321 0.7
322 0.72
323 0.77
324 0.78
325 0.78
326 0.79
327 0.81
328 0.79
329 0.77
330 0.75
331 0.71
332 0.67