Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7K059

Protein Details
Accession L7K059   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
36-58SESVSNSRRVQKKKRACENCVCGHydrophilic
NLS Segment(s)
PositionSequence
64-65KK
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007785  Anamorsin  
IPR046408  CIAPIN1  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF05093  CIAPIN1  
Amino Acid Sequences MATENDDFKKLLEGALKVKNRRTEEDEKDFLDEDASESVSNSRRVQKKKRACENCVCGRAEGKKKLSREELKKMSREEVKKLANAGCGGCKMGDAFRCGDCPFYGLPSFEEGDEVFFD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.34
3 0.4
4 0.4
5 0.46
6 0.52
7 0.52
8 0.55
9 0.58
10 0.58
11 0.6
12 0.64
13 0.61
14 0.54
15 0.52
16 0.46
17 0.38
18 0.29
19 0.2
20 0.13
21 0.11
22 0.1
23 0.08
24 0.08
25 0.1
26 0.13
27 0.16
28 0.17
29 0.24
30 0.31
31 0.4
32 0.49
33 0.57
34 0.64
35 0.72
36 0.8
37 0.81
38 0.79
39 0.8
40 0.78
41 0.75
42 0.7
43 0.6
44 0.49
45 0.44
46 0.44
47 0.42
48 0.4
49 0.38
50 0.39
51 0.4
52 0.44
53 0.5
54 0.52
55 0.53
56 0.56
57 0.59
58 0.6
59 0.63
60 0.6
61 0.57
62 0.56
63 0.52
64 0.48
65 0.47
66 0.44
67 0.41
68 0.43
69 0.38
70 0.33
71 0.31
72 0.27
73 0.21
74 0.18
75 0.17
76 0.14
77 0.12
78 0.11
79 0.13
80 0.14
81 0.15
82 0.17
83 0.17
84 0.2
85 0.2
86 0.21
87 0.17
88 0.17
89 0.16
90 0.18
91 0.19
92 0.17
93 0.18
94 0.2
95 0.2
96 0.18
97 0.19
98 0.15