Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L7JU11

Protein Details
Accession L7JU11    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
35-57NPLMCKKLANRHKKQSAIRRVSDHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11, nucl 10.5, cyto 8.5, mito 8
Family & Domain DBs
Amino Acid Sequences MIVGISRERMPAARDELRLYVDCDYARCIVFARLNPLMCKKLANRHKKQSAIRRVSDPAPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.3
4 0.31
5 0.3
6 0.27
7 0.21
8 0.18
9 0.17
10 0.15
11 0.16
12 0.14
13 0.13
14 0.12
15 0.11
16 0.12
17 0.14
18 0.14
19 0.17
20 0.18
21 0.19
22 0.21
23 0.23
24 0.23
25 0.21
26 0.23
27 0.22
28 0.29
29 0.38
30 0.47
31 0.53
32 0.62
33 0.7
34 0.75
35 0.81
36 0.82
37 0.84
38 0.82
39 0.77
40 0.72
41 0.69