Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7JWI7

Protein Details
Accession L7JWI7    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
162-188YFNIKLDNKTRNRLKKRNNWPTFPQIYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.333, cyto 13, nucl 12.5, cyto_pero 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR002109  Glutaredoxin  
IPR004480  Monothiol_GRX-rel  
IPR036249  Thioredoxin-like_sf  
Gene Ontology GO:0015036  F:disulfide oxidoreductase activity  
Pfam View protein in Pfam  
PF00462  Glutaredoxin  
PROSITE View protein in PROSITE  
PS51354  GLUTAREDOXIN_2  
Amino Acid Sequences VSFPMDRSPHELSAEEKKNEDELNNIFFKLQNYTNIIAHENDEQEIDALLKYIDDDEYIIVNLSISPVLKERFMKTYSVEKLPILISYSTNIYNDENVDAYLKERKVNEDSFIDHKIDKMVGEKKVMVFIKGSPDKPECKFTKELISHFDELQLKNGKDYSYFNIKLDNKTRNRLKKRNNWPTFPQIYIDKLFVGGLDTFKKMKEKKIVQKMLFPGDQEEIE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.37
4 0.36
5 0.37
6 0.37
7 0.34
8 0.29
9 0.24
10 0.28
11 0.28
12 0.26
13 0.24
14 0.23
15 0.24
16 0.24
17 0.22
18 0.22
19 0.25
20 0.27
21 0.29
22 0.28
23 0.29
24 0.25
25 0.24
26 0.23
27 0.19
28 0.17
29 0.15
30 0.14
31 0.12
32 0.11
33 0.1
34 0.07
35 0.06
36 0.06
37 0.05
38 0.05
39 0.06
40 0.05
41 0.05
42 0.05
43 0.06
44 0.07
45 0.07
46 0.07
47 0.06
48 0.06
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.08
55 0.09
56 0.12
57 0.15
58 0.17
59 0.21
60 0.22
61 0.22
62 0.23
63 0.3
64 0.31
65 0.32
66 0.31
67 0.26
68 0.26
69 0.25
70 0.22
71 0.16
72 0.13
73 0.1
74 0.1
75 0.12
76 0.11
77 0.11
78 0.12
79 0.1
80 0.1
81 0.1
82 0.1
83 0.08
84 0.08
85 0.08
86 0.07
87 0.08
88 0.12
89 0.12
90 0.14
91 0.14
92 0.17
93 0.21
94 0.22
95 0.23
96 0.2
97 0.22
98 0.22
99 0.23
100 0.21
101 0.17
102 0.16
103 0.14
104 0.13
105 0.11
106 0.13
107 0.16
108 0.16
109 0.18
110 0.18
111 0.18
112 0.23
113 0.23
114 0.19
115 0.15
116 0.15
117 0.22
118 0.25
119 0.26
120 0.24
121 0.27
122 0.31
123 0.32
124 0.4
125 0.33
126 0.34
127 0.37
128 0.35
129 0.41
130 0.4
131 0.39
132 0.36
133 0.39
134 0.35
135 0.32
136 0.35
137 0.29
138 0.26
139 0.31
140 0.32
141 0.27
142 0.27
143 0.28
144 0.24
145 0.22
146 0.24
147 0.23
148 0.26
149 0.28
150 0.27
151 0.34
152 0.37
153 0.42
154 0.46
155 0.51
156 0.46
157 0.54
158 0.64
159 0.66
160 0.74
161 0.77
162 0.81
163 0.82
164 0.89
165 0.91
166 0.89
167 0.85
168 0.81
169 0.81
170 0.75
171 0.65
172 0.57
173 0.49
174 0.45
175 0.4
176 0.34
177 0.24
178 0.2
179 0.19
180 0.15
181 0.14
182 0.11
183 0.12
184 0.13
185 0.16
186 0.16
187 0.18
188 0.27
189 0.28
190 0.36
191 0.44
192 0.52
193 0.6
194 0.71
195 0.79
196 0.74
197 0.78
198 0.76
199 0.73
200 0.64
201 0.55
202 0.47