Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L7JRK8

Protein Details
Accession L7JRK8    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
13-38EKSSEVEEKKRIKPNKTRKSVLDNISHydrophilic
NLS Segment(s)
PositionSequence
22-26KRIKP
Subcellular Location(s) nucl 18, cyto_nucl 13.5, cyto 7
Family & Domain DBs
Amino Acid Sequences MEYNLYNPLKTDEKSSEVEEKKRIKPNKTRKSVLDNISYIETPISTDLKNFIMEETGKHYEKVLPVIERLCTDHVGTDLYERLNNELLPFLGEDTKKFVGRLLFYKKRSCRDGNRCQNLKNCIFIHDVSDEVIFNRVPSAFSDPHVLEKYAKEYGNVFSIKMLNQQKFLVKYDSVQSALQCINDQAPVLGNKEIKKFFNRRRVDVKDLFREHDELLIALFAKGEKKFAMRLKNVSNRIKEALENSRKQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.38
3 0.43
4 0.44
5 0.49
6 0.52
7 0.55
8 0.59
9 0.66
10 0.7
11 0.7
12 0.75
13 0.81
14 0.83
15 0.85
16 0.83
17 0.8
18 0.81
19 0.8
20 0.75
21 0.72
22 0.61
23 0.54
24 0.5
25 0.43
26 0.34
27 0.25
28 0.19
29 0.12
30 0.13
31 0.13
32 0.11
33 0.11
34 0.13
35 0.14
36 0.15
37 0.15
38 0.12
39 0.13
40 0.14
41 0.14
42 0.19
43 0.23
44 0.23
45 0.23
46 0.24
47 0.24
48 0.25
49 0.28
50 0.24
51 0.2
52 0.22
53 0.23
54 0.23
55 0.21
56 0.21
57 0.19
58 0.17
59 0.15
60 0.14
61 0.13
62 0.13
63 0.12
64 0.11
65 0.11
66 0.1
67 0.12
68 0.11
69 0.13
70 0.13
71 0.13
72 0.11
73 0.1
74 0.1
75 0.09
76 0.09
77 0.08
78 0.1
79 0.1
80 0.1
81 0.14
82 0.16
83 0.16
84 0.16
85 0.17
86 0.17
87 0.19
88 0.25
89 0.3
90 0.35
91 0.38
92 0.47
93 0.5
94 0.53
95 0.57
96 0.57
97 0.58
98 0.61
99 0.68
100 0.71
101 0.75
102 0.73
103 0.7
104 0.69
105 0.65
106 0.56
107 0.5
108 0.4
109 0.33
110 0.32
111 0.28
112 0.24
113 0.18
114 0.17
115 0.12
116 0.12
117 0.09
118 0.07
119 0.08
120 0.06
121 0.06
122 0.06
123 0.06
124 0.06
125 0.07
126 0.13
127 0.12
128 0.13
129 0.17
130 0.17
131 0.2
132 0.21
133 0.21
134 0.17
135 0.17
136 0.19
137 0.2
138 0.2
139 0.17
140 0.17
141 0.17
142 0.21
143 0.2
144 0.17
145 0.14
146 0.15
147 0.15
148 0.22
149 0.27
150 0.23
151 0.25
152 0.26
153 0.29
154 0.3
155 0.32
156 0.28
157 0.22
158 0.22
159 0.24
160 0.25
161 0.23
162 0.21
163 0.19
164 0.18
165 0.19
166 0.17
167 0.14
168 0.13
169 0.12
170 0.11
171 0.11
172 0.08
173 0.1
174 0.11
175 0.13
176 0.15
177 0.18
178 0.2
179 0.26
180 0.29
181 0.3
182 0.37
183 0.46
184 0.52
185 0.59
186 0.62
187 0.63
188 0.7
189 0.74
190 0.74
191 0.73
192 0.71
193 0.71
194 0.68
195 0.65
196 0.57
197 0.52
198 0.44
199 0.37
200 0.29
201 0.19
202 0.16
203 0.14
204 0.12
205 0.09
206 0.09
207 0.07
208 0.11
209 0.12
210 0.13
211 0.14
212 0.16
213 0.24
214 0.3
215 0.39
216 0.41
217 0.48
218 0.57
219 0.65
220 0.72
221 0.73
222 0.72
223 0.67
224 0.65
225 0.59
226 0.52
227 0.49
228 0.51
229 0.52