Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7JYM7

Protein Details
Accession L7JYM7   
Localization Confidence Medium
Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
96-116MAKSSIKRVKKYLKENFEKEEHydrophilic
NLS Segment(s)
PositionSequence
103-110RVKKYLKE
113-121EKEEKMKRR
Subcellular Location(s) nucl 11.5, mito 11, cyto_nucl 9.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002759  Pop5/Rpp14/Rnp2-like  
IPR016819  RNase_P/MRP_POP5  
IPR038085  Rnp2-like_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0030677  C:ribonuclease P complex  
GO:0004526  F:ribonuclease P activity  
GO:0033204  F:ribonuclease P RNA binding  
GO:0001682  P:tRNA 5'-leader removal  
Pfam View protein in Pfam  
PF01900  RNase_P_Rpp14  
Amino Acid Sequences MVTKKVRYVIFKIESGNNTLLKMSEESLLNIFRDQMYEMYGSFGMMHFQNVYITLFLLYNQIIVLKVPRVVKNEICYAMQHCKNIAGRNVKFNPVMAKSSIKRVKKYLKENFEKEEKMKRRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.4
4 0.31
5 0.27
6 0.25
7 0.22
8 0.18
9 0.18
10 0.14
11 0.14
12 0.13
13 0.14
14 0.16
15 0.17
16 0.15
17 0.14
18 0.14
19 0.11
20 0.11
21 0.11
22 0.09
23 0.09
24 0.09
25 0.09
26 0.1
27 0.1
28 0.09
29 0.08
30 0.08
31 0.07
32 0.07
33 0.07
34 0.06
35 0.06
36 0.06
37 0.07
38 0.07
39 0.06
40 0.06
41 0.06
42 0.06
43 0.06
44 0.07
45 0.06
46 0.05
47 0.05
48 0.05
49 0.04
50 0.05
51 0.05
52 0.05
53 0.09
54 0.12
55 0.15
56 0.18
57 0.22
58 0.24
59 0.26
60 0.29
61 0.27
62 0.25
63 0.23
64 0.23
65 0.28
66 0.28
67 0.26
68 0.23
69 0.26
70 0.29
71 0.32
72 0.35
73 0.37
74 0.36
75 0.45
76 0.47
77 0.45
78 0.43
79 0.4
80 0.39
81 0.32
82 0.33
83 0.26
84 0.31
85 0.29
86 0.39
87 0.46
88 0.46
89 0.48
90 0.54
91 0.62
92 0.65
93 0.74
94 0.74
95 0.76
96 0.8
97 0.81
98 0.79
99 0.77
100 0.73
101 0.68
102 0.68