Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L7JXX5

Protein Details
Accession L7JXX5    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
92-111LEDTKHKKKANKKYLAHGEDBasic
NLS Segment(s)
PositionSequence
96-103KHKKKANK
Subcellular Location(s) mito 6, E.R. 6, extr 4, nucl 3, pero 3, golg 2, cyto_pero 2
Family & Domain DBs
Amino Acid Sequences MNLGRCHMVTISLFCIANTILLKNFVGTVKYGEEMRNSAEEENESVNGNEVSVEKTVIKNRMVGMLLDLAGIQFSNETSGRMAASNIKKDRLEDTKHKKKANKKYLAHGEDVTEESVTSSFTGTRNKKVEKIGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.15
4 0.16
5 0.15
6 0.14
7 0.12
8 0.14
9 0.14
10 0.13
11 0.14
12 0.12
13 0.12
14 0.11
15 0.13
16 0.12
17 0.14
18 0.15
19 0.14
20 0.15
21 0.15
22 0.16
23 0.16
24 0.16
25 0.15
26 0.14
27 0.14
28 0.13
29 0.14
30 0.12
31 0.11
32 0.1
33 0.11
34 0.1
35 0.09
36 0.08
37 0.07
38 0.08
39 0.07
40 0.08
41 0.08
42 0.1
43 0.14
44 0.17
45 0.17
46 0.17
47 0.17
48 0.19
49 0.19
50 0.16
51 0.14
52 0.1
53 0.1
54 0.08
55 0.08
56 0.05
57 0.04
58 0.04
59 0.03
60 0.02
61 0.02
62 0.05
63 0.05
64 0.06
65 0.06
66 0.07
67 0.07
68 0.08
69 0.08
70 0.14
71 0.18
72 0.25
73 0.27
74 0.3
75 0.3
76 0.31
77 0.36
78 0.36
79 0.39
80 0.41
81 0.5
82 0.58
83 0.65
84 0.7
85 0.72
86 0.75
87 0.8
88 0.8
89 0.8
90 0.74
91 0.77
92 0.81
93 0.77
94 0.71
95 0.6
96 0.51
97 0.42
98 0.39
99 0.29
100 0.19
101 0.15
102 0.12
103 0.11
104 0.1
105 0.08
106 0.07
107 0.08
108 0.11
109 0.22
110 0.25
111 0.34
112 0.42
113 0.46
114 0.51