Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7JWV1

Protein Details
Accession L7JWV1    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
82-114LPRLTKKKRMELSKEQLRKCRNGKSRAYKGGLRHydrophilic
NLS Segment(s)
PositionSequence
84-108RLTKKKRMELSKEQLRKCRNGKSRA
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
Amino Acid Sequences MKISAKELRTLPLPDLEERYKQIKTELLHVRQKQHTHTVKPHEIYNAHRNVAVVMSVLTEKKKEEAVAAAFAASGKVPRQFLPRLTKKKRMELSKEQLRKCRNGKSRAYKGGLRRVLFAYAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.34
4 0.33
5 0.35
6 0.37
7 0.32
8 0.3
9 0.3
10 0.29
11 0.27
12 0.33
13 0.38
14 0.42
15 0.49
16 0.52
17 0.57
18 0.58
19 0.6
20 0.55
21 0.56
22 0.55
23 0.53
24 0.57
25 0.59
26 0.59
27 0.57
28 0.55
29 0.49
30 0.44
31 0.44
32 0.44
33 0.39
34 0.33
35 0.32
36 0.3
37 0.26
38 0.23
39 0.17
40 0.09
41 0.05
42 0.05
43 0.05
44 0.06
45 0.06
46 0.07
47 0.07
48 0.08
49 0.08
50 0.08
51 0.08
52 0.1
53 0.11
54 0.11
55 0.11
56 0.1
57 0.09
58 0.08
59 0.08
60 0.05
61 0.05
62 0.05
63 0.08
64 0.09
65 0.11
66 0.16
67 0.19
68 0.26
69 0.36
70 0.45
71 0.53
72 0.6
73 0.68
74 0.69
75 0.76
76 0.77
77 0.76
78 0.75
79 0.75
80 0.78
81 0.78
82 0.81
83 0.77
84 0.77
85 0.73
86 0.73
87 0.69
88 0.69
89 0.68
90 0.69
91 0.74
92 0.77
93 0.81
94 0.82
95 0.81
96 0.77
97 0.76
98 0.77
99 0.74
100 0.64
101 0.58
102 0.51