Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L7JVF9

Protein Details
Accession L7JVF9    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
20-39SSLRKRAKICMDQKKKKYECHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22.5, mito_nucl 13.833, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002674  Ribosomal_L37ae  
IPR011331  Ribosomal_L37ae/L37e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01780  Ribosomal_L37ae  
Amino Acid Sequences MSKRIKKVGITGKFGVRYGSSLRKRAKICMDQKKKKYECPFCGKSNVRWQAIGLWKCKSCEKVMSGGGYTFETPLHCTIKQTLSRTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.43
3 0.33
4 0.28
5 0.27
6 0.33
7 0.33
8 0.39
9 0.44
10 0.49
11 0.5
12 0.54
13 0.57
14 0.57
15 0.62
16 0.65
17 0.71
18 0.74
19 0.79
20 0.83
21 0.78
22 0.76
23 0.77
24 0.75
25 0.72
26 0.72
27 0.69
28 0.61
29 0.67
30 0.61
31 0.55
32 0.56
33 0.54
34 0.46
35 0.41
36 0.38
37 0.35
38 0.41
39 0.4
40 0.33
41 0.3
42 0.3
43 0.32
44 0.35
45 0.32
46 0.27
47 0.28
48 0.28
49 0.3
50 0.32
51 0.32
52 0.3
53 0.27
54 0.26
55 0.21
56 0.19
57 0.14
58 0.12
59 0.11
60 0.12
61 0.16
62 0.19
63 0.18
64 0.21
65 0.25
66 0.33
67 0.39