Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L7JV31

Protein Details
Accession L7JV31    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-37MAQKKRQSKRRTFNRRKRKIFKSTLKKDKKVPPSILRBasic
NLS Segment(s)
PositionSequence
4-31KKRQSKRRTFNRRKRKIFKSTLKKDKKV
Subcellular Location(s) nucl 20, mito_nucl 12.833, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
Amino Acid Sequences MAQKKRQSKRRTFNRRKRKIFKSTLKKDKKVPPSILRTDDSTAALTKIRMLEKQRNAGHGTHAATRPILLNSRDPVSVDGDVYMDNNSPVSDYWKKKTSAKDFDPTKKYDVPNTPYTQILSGRVPNKEKTYGVFGDMIAYLSVKEVCLHFCLPVFESVNEFVEVFEEEYGLKGWREVAAKVFGEMKKDKIYFYRDINGVMNFEIRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.95
2 0.96
3 0.96
4 0.95
5 0.94
6 0.93
7 0.93
8 0.93
9 0.92
10 0.92
11 0.93
12 0.93
13 0.88
14 0.86
15 0.85
16 0.85
17 0.83
18 0.81
19 0.79
20 0.77
21 0.79
22 0.74
23 0.66
24 0.59
25 0.52
26 0.45
27 0.37
28 0.29
29 0.23
30 0.19
31 0.18
32 0.14
33 0.14
34 0.16
35 0.17
36 0.2
37 0.26
38 0.35
39 0.4
40 0.49
41 0.49
42 0.49
43 0.5
44 0.46
45 0.42
46 0.37
47 0.33
48 0.29
49 0.28
50 0.25
51 0.22
52 0.22
53 0.2
54 0.17
55 0.19
56 0.16
57 0.17
58 0.19
59 0.2
60 0.2
61 0.19
62 0.19
63 0.17
64 0.16
65 0.13
66 0.11
67 0.1
68 0.09
69 0.09
70 0.08
71 0.06
72 0.05
73 0.05
74 0.05
75 0.05
76 0.05
77 0.11
78 0.18
79 0.21
80 0.25
81 0.3
82 0.32
83 0.37
84 0.46
85 0.49
86 0.5
87 0.51
88 0.56
89 0.57
90 0.63
91 0.62
92 0.56
93 0.51
94 0.47
95 0.43
96 0.41
97 0.41
98 0.39
99 0.4
100 0.41
101 0.38
102 0.33
103 0.33
104 0.28
105 0.22
106 0.19
107 0.16
108 0.18
109 0.2
110 0.24
111 0.26
112 0.27
113 0.3
114 0.3
115 0.29
116 0.26
117 0.28
118 0.25
119 0.24
120 0.22
121 0.18
122 0.16
123 0.16
124 0.14
125 0.09
126 0.08
127 0.06
128 0.06
129 0.06
130 0.05
131 0.06
132 0.06
133 0.08
134 0.1
135 0.11
136 0.11
137 0.12
138 0.13
139 0.14
140 0.17
141 0.18
142 0.16
143 0.18
144 0.19
145 0.19
146 0.18
147 0.17
148 0.13
149 0.11
150 0.12
151 0.1
152 0.08
153 0.07
154 0.06
155 0.07
156 0.08
157 0.09
158 0.08
159 0.07
160 0.09
161 0.12
162 0.14
163 0.14
164 0.17
165 0.21
166 0.22
167 0.23
168 0.28
169 0.26
170 0.3
171 0.31
172 0.32
173 0.35
174 0.35
175 0.37
176 0.36
177 0.42
178 0.41
179 0.44
180 0.47
181 0.41
182 0.43
183 0.44
184 0.39
185 0.34
186 0.29