Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S0H2

Protein Details
Accession E3S0H2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
2-21STPQAKRRRLNDATKTLQKPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 8
Family & Domain DBs
KEGG pte:PTT_15549  -  
Amino Acid Sequences MSTPQAKRRRLNDATKTLQKPFKSPFRTPLKPSIGDDPPSSDPPDFHVSTQMTPTATVAAPKCVASSSNSGQQFASVAVPSQVPATPVASKPRISKPLVSRPNFSTPSRVISKKIPSKPSLTREIMQLRNEIQMLKQAQTLATSTKDDDLVVLVDKWRTASRAAAEELFGSTRDRVNRMGGVGAWKEREKESKERRLKWDQEEMVAEREKMEEAKENGELSEETYDRYAEMDGEREKGEEEKETFKGADDDSFTMDMMLKTLNIDLKLIGYSKEAQRWDG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.79
4 0.76
5 0.74
6 0.65
7 0.62
8 0.61
9 0.62
10 0.61
11 0.61
12 0.63
13 0.66
14 0.72
15 0.71
16 0.72
17 0.7
18 0.65
19 0.63
20 0.61
21 0.56
22 0.52
23 0.47
24 0.42
25 0.39
26 0.38
27 0.37
28 0.3
29 0.25
30 0.27
31 0.33
32 0.28
33 0.24
34 0.29
35 0.28
36 0.28
37 0.3
38 0.27
39 0.21
40 0.2
41 0.19
42 0.15
43 0.13
44 0.16
45 0.15
46 0.16
47 0.17
48 0.17
49 0.17
50 0.15
51 0.15
52 0.14
53 0.2
54 0.2
55 0.27
56 0.27
57 0.28
58 0.27
59 0.26
60 0.24
61 0.18
62 0.16
63 0.09
64 0.08
65 0.08
66 0.08
67 0.08
68 0.09
69 0.08
70 0.08
71 0.09
72 0.11
73 0.12
74 0.14
75 0.2
76 0.22
77 0.24
78 0.29
79 0.35
80 0.39
81 0.39
82 0.44
83 0.46
84 0.54
85 0.61
86 0.59
87 0.55
88 0.54
89 0.59
90 0.56
91 0.48
92 0.43
93 0.35
94 0.38
95 0.39
96 0.36
97 0.3
98 0.33
99 0.41
100 0.45
101 0.5
102 0.5
103 0.48
104 0.53
105 0.57
106 0.56
107 0.55
108 0.49
109 0.43
110 0.43
111 0.47
112 0.45
113 0.39
114 0.35
115 0.29
116 0.27
117 0.26
118 0.2
119 0.14
120 0.15
121 0.15
122 0.14
123 0.14
124 0.13
125 0.13
126 0.13
127 0.14
128 0.1
129 0.1
130 0.1
131 0.09
132 0.1
133 0.1
134 0.09
135 0.08
136 0.07
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.06
143 0.07
144 0.07
145 0.08
146 0.08
147 0.11
148 0.12
149 0.14
150 0.16
151 0.15
152 0.14
153 0.13
154 0.13
155 0.11
156 0.1
157 0.08
158 0.08
159 0.11
160 0.12
161 0.14
162 0.15
163 0.17
164 0.17
165 0.17
166 0.17
167 0.14
168 0.16
169 0.16
170 0.16
171 0.16
172 0.16
173 0.17
174 0.19
175 0.25
176 0.26
177 0.36
178 0.44
179 0.52
180 0.61
181 0.66
182 0.72
183 0.76
184 0.78
185 0.73
186 0.73
187 0.64
188 0.58
189 0.54
190 0.48
191 0.42
192 0.36
193 0.3
194 0.2
195 0.19
196 0.17
197 0.14
198 0.14
199 0.16
200 0.17
201 0.19
202 0.2
203 0.2
204 0.19
205 0.2
206 0.19
207 0.14
208 0.16
209 0.13
210 0.13
211 0.13
212 0.13
213 0.12
214 0.12
215 0.11
216 0.09
217 0.1
218 0.14
219 0.14
220 0.17
221 0.17
222 0.17
223 0.17
224 0.18
225 0.18
226 0.19
227 0.21
228 0.23
229 0.24
230 0.27
231 0.26
232 0.25
233 0.26
234 0.21
235 0.21
236 0.2
237 0.19
238 0.2
239 0.2
240 0.19
241 0.17
242 0.17
243 0.14
244 0.12
245 0.11
246 0.08
247 0.09
248 0.11
249 0.14
250 0.13
251 0.14
252 0.13
253 0.14
254 0.16
255 0.16
256 0.14
257 0.14
258 0.19
259 0.24
260 0.3