Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7JZQ6

Protein Details
Accession L7JZQ6    Localization Confidence Low Confidence Score 8.5
NoLS Segment(s)
PositionSequenceProtein Nature
207-231DIKRLPCKAFHMKKNCSRKNCMFSHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, mito_nucl 12.333, cyto_nucl 9.833, mito 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045124  Su(sable)-like  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0045892  P:negative regulation of DNA-templated transcription  
GO:0016070  P:RNA metabolic process  
Pfam View protein in Pfam  
PF00642  zf-CCCH  
PF14608  zf-CCCH_2  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences VGIILQFVSFYYFKNVSKQRTLMIRRMLVPTKLCKALLRFRTAILTDSDLKDELKDVSEAKNDTMNNKQDYGKTEEDELEEGEVYIKRKRVVSESYQGEKRLKYVNCDVIIDKTARSEDDLDDEAEKKTMLCDKKYFLYDSSDNDSDTEPKNITKPIKNSVNVSRQPIQTPQRRTDSTKQSNYRSQICRFFLTHSCTKGDACSYSHDIKRLPCKAFHMKKNCSRKNCMFSHEPISVAELNRMAESEKWENNDFVSPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.39
3 0.42
4 0.49
5 0.5
6 0.49
7 0.56
8 0.6
9 0.59
10 0.59
11 0.57
12 0.53
13 0.58
14 0.56
15 0.51
16 0.5
17 0.48
18 0.46
19 0.45
20 0.42
21 0.4
22 0.42
23 0.46
24 0.48
25 0.48
26 0.44
27 0.42
28 0.45
29 0.42
30 0.37
31 0.3
32 0.27
33 0.24
34 0.24
35 0.25
36 0.21
37 0.2
38 0.18
39 0.17
40 0.14
41 0.12
42 0.12
43 0.12
44 0.15
45 0.19
46 0.2
47 0.19
48 0.23
49 0.22
50 0.24
51 0.3
52 0.33
53 0.31
54 0.33
55 0.34
56 0.32
57 0.36
58 0.39
59 0.34
60 0.29
61 0.29
62 0.27
63 0.26
64 0.24
65 0.2
66 0.14
67 0.11
68 0.1
69 0.09
70 0.1
71 0.11
72 0.13
73 0.15
74 0.16
75 0.18
76 0.2
77 0.23
78 0.27
79 0.32
80 0.37
81 0.41
82 0.44
83 0.45
84 0.46
85 0.43
86 0.38
87 0.34
88 0.34
89 0.28
90 0.28
91 0.31
92 0.35
93 0.33
94 0.34
95 0.32
96 0.26
97 0.27
98 0.23
99 0.17
100 0.12
101 0.11
102 0.1
103 0.11
104 0.1
105 0.09
106 0.11
107 0.12
108 0.12
109 0.12
110 0.13
111 0.12
112 0.1
113 0.1
114 0.07
115 0.07
116 0.12
117 0.14
118 0.16
119 0.18
120 0.2
121 0.23
122 0.25
123 0.25
124 0.21
125 0.24
126 0.22
127 0.23
128 0.27
129 0.24
130 0.23
131 0.22
132 0.22
133 0.19
134 0.19
135 0.17
136 0.13
137 0.13
138 0.14
139 0.19
140 0.23
141 0.26
142 0.28
143 0.34
144 0.41
145 0.42
146 0.45
147 0.48
148 0.52
149 0.49
150 0.51
151 0.49
152 0.43
153 0.43
154 0.46
155 0.47
156 0.45
157 0.48
158 0.48
159 0.5
160 0.52
161 0.57
162 0.59
163 0.62
164 0.63
165 0.67
166 0.68
167 0.67
168 0.7
169 0.68
170 0.68
171 0.63
172 0.59
173 0.57
174 0.54
175 0.51
176 0.46
177 0.45
178 0.43
179 0.43
180 0.43
181 0.37
182 0.36
183 0.34
184 0.33
185 0.31
186 0.27
187 0.23
188 0.19
189 0.22
190 0.26
191 0.31
192 0.33
193 0.34
194 0.34
195 0.38
196 0.47
197 0.49
198 0.46
199 0.43
200 0.49
201 0.57
202 0.63
203 0.67
204 0.67
205 0.69
206 0.76
207 0.84
208 0.85
209 0.82
210 0.82
211 0.82
212 0.81
213 0.76
214 0.73
215 0.67
216 0.63
217 0.62
218 0.54
219 0.45
220 0.37
221 0.36
222 0.33
223 0.27
224 0.25
225 0.2
226 0.2
227 0.19
228 0.19
229 0.16
230 0.15
231 0.21
232 0.26
233 0.28
234 0.32
235 0.34
236 0.34
237 0.35