FuNGI

L7JYG9

Protein Details

Accession

L7JYG9

Localization Confidence

Low

Confidence Score

6.8

NoLS Segment(s)

Position	Sequence	Protein Nature
436-458	IVPQVLKDKKRIFENRKIYRSNF	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 12, cyto 8, cyto_nucl 8, nucl 6

Family & Domain DBs

InterPro	View protein in InterPro IPR009016 Fe_hydrogenase IPR004108 Fe_hydrogenase_lsu_C
Gene Ontology	GO:0051539 F:4 iron, 4 sulfur cluster binding GO:0008901 F:ferredoxin hydrogenase activity
Pfam	View protein in Pfam PF02906 Fe_hyd_lg_C

Amino Acid Sequences

MRRPHMNKKINPCIKGEKPFELTLNDCLACSGCVSMEETKITAEDLQNVPINLIMSHYSVLNLCNEIKKQQLKQNKDDSTNLHAITVKEWYAYLQNALRRKFSVKRIVNTYDYQQLSNYMIYNELLTKNKLILSECPGVVAYVERRRPDLIPYLSEVPSLQQMCAYLCEEEGVLTVGVMQCHDKRLEGGVRVDYVLSSKDIYEICSDVRINFEVDNNDRDIYDDVGVGNEGKGDNNGRDIHDDVGVGNEGKGDNNGRDTYDDVGVGNEGKGDNNGRDIYDDVGVNGKDNNIYETCNGVHTNDKDDNNTNTHNDRLSPEQHSKNSSEHVLTNEKEFLTGITPYLIKMLNLTIERIQTINKSYRVLHFKNSSLTFAHITGLKNLLNFLNDEEMRYNFVDIFLCDDRCFGGPGQIKNNVQNDYAHYFKLVGLNTNEEVIVPQVLKDKKRIFENRKIYRSNFKVEW

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.72
2	0.73
3	0.68
4	0.64
5	0.61
6	0.61
7	0.57
8	0.51
9	0.46
10	0.4
11	0.39
12	0.32
13	0.27
14	0.25
15	0.23
16	0.19
17	0.16
18	0.13
19	0.08
20	0.09
21	0.12
22	0.14
23	0.15
24	0.16
25	0.16
26	0.16
27	0.16
28	0.16
29	0.17
30	0.15
31	0.19
32	0.19
33	0.23
34	0.25
35	0.24
36	0.23
37	0.21
38	0.2
39	0.14
40	0.14
41	0.12
42	0.11
43	0.11
44	0.11
45	0.11
46	0.11
47	0.12
48	0.12
49	0.13
50	0.14
51	0.18
52	0.2
53	0.22
54	0.29
55	0.36
56	0.41
57	0.48
58	0.56
59	0.59
60	0.67
61	0.74
62	0.72
63	0.69
64	0.67
65	0.62
66	0.6
67	0.57
68	0.48
69	0.39
70	0.35
71	0.31
72	0.28
73	0.27
74	0.19
75	0.14
76	0.14
77	0.14
78	0.14
79	0.14
80	0.17
81	0.18
82	0.23
83	0.29
84	0.32
85	0.33
86	0.32
87	0.37
88	0.41
89	0.46
90	0.51
91	0.52
92	0.56
93	0.61
94	0.64
95	0.63
96	0.58
97	0.52
98	0.49
99	0.43
100	0.37
101	0.3
102	0.27
103	0.24
104	0.23
105	0.2
106	0.12
107	0.12
108	0.12
109	0.12
110	0.13
111	0.14
112	0.15
113	0.16
114	0.16
115	0.16
116	0.18
117	0.18
118	0.18
119	0.18
120	0.22
121	0.25
122	0.24
123	0.23
124	0.22
125	0.2
126	0.18
127	0.17
128	0.16
129	0.2
130	0.24
131	0.24
132	0.26
133	0.28
134	0.29
135	0.3
136	0.33
137	0.29
138	0.27
139	0.29
140	0.32
141	0.3
142	0.29
143	0.25
144	0.17
145	0.2
146	0.18
147	0.15
148	0.11
149	0.12
150	0.12
151	0.14
152	0.14
153	0.09
154	0.08
155	0.09
156	0.08
157	0.07
158	0.07
159	0.06
160	0.05
161	0.04
162	0.05
163	0.06
164	0.06
165	0.06
166	0.08
167	0.08
168	0.1
169	0.11
170	0.1
171	0.1
172	0.14
173	0.17
174	0.18
175	0.2
176	0.18
177	0.19
178	0.18
179	0.18
180	0.14
181	0.11
182	0.09
183	0.07
184	0.07
185	0.06
186	0.08
187	0.08
188	0.1
189	0.1
190	0.1
191	0.09
192	0.11
193	0.11
194	0.09
195	0.11
196	0.11
197	0.1
198	0.1
199	0.12
200	0.12
201	0.14
202	0.15
203	0.15
204	0.14
205	0.13
206	0.14
207	0.13
208	0.11
209	0.1
210	0.08
211	0.07
212	0.07
213	0.07
214	0.06
215	0.05
216	0.04
217	0.04
218	0.04
219	0.05
220	0.06
221	0.06
222	0.09
223	0.1
224	0.11
225	0.12
226	0.13
227	0.13
228	0.13
229	0.12
230	0.09
231	0.09
232	0.09
233	0.07
234	0.06
235	0.05
236	0.05
237	0.05
238	0.06
239	0.06
240	0.07
241	0.09
242	0.1
243	0.1
244	0.1
245	0.12
246	0.13
247	0.12
248	0.12
249	0.09
250	0.09
251	0.09
252	0.08
253	0.07
254	0.05
255	0.05
256	0.05
257	0.05
258	0.06
259	0.06
260	0.09
261	0.09
262	0.09
263	0.1
264	0.11
265	0.11
266	0.11
267	0.11
268	0.09
269	0.11
270	0.11
271	0.11
272	0.1
273	0.09
274	0.09
275	0.09
276	0.11
277	0.09
278	0.1
279	0.11
280	0.12
281	0.12
282	0.13
283	0.14
284	0.12
285	0.17
286	0.17
287	0.22
288	0.26
289	0.26
290	0.28
291	0.31
292	0.33
293	0.31
294	0.32
295	0.3
296	0.26
297	0.27
298	0.25
299	0.23
300	0.22
301	0.23
302	0.25
303	0.28
304	0.33
305	0.38
306	0.4
307	0.42
308	0.42
309	0.4
310	0.39
311	0.35
312	0.3
313	0.25
314	0.26
315	0.28
316	0.26
317	0.27
318	0.26
319	0.23
320	0.21
321	0.2
322	0.16
323	0.12
324	0.12
325	0.1
326	0.09
327	0.09
328	0.09
329	0.12
330	0.11
331	0.09
332	0.1
333	0.1
334	0.13
335	0.13
336	0.15
337	0.15
338	0.16
339	0.17
340	0.16
341	0.17
342	0.15
343	0.2
344	0.25
345	0.25
346	0.26
347	0.28
348	0.35
349	0.43
350	0.43
351	0.45
352	0.44
353	0.44
354	0.49
355	0.49
356	0.43
357	0.35
358	0.36
359	0.3
360	0.25
361	0.24
362	0.2
363	0.2
364	0.2
365	0.22
366	0.2
367	0.18
368	0.19
369	0.18
370	0.16
371	0.15
372	0.15
373	0.19
374	0.18
375	0.2
376	0.2
377	0.2
378	0.22
379	0.22
380	0.21
381	0.14
382	0.15
383	0.14
384	0.12
385	0.18
386	0.18
387	0.19
388	0.18
389	0.18
390	0.19
391	0.19
392	0.21
393	0.15
394	0.2
395	0.25
396	0.3
397	0.35
398	0.41
399	0.43
400	0.48
401	0.53
402	0.46
403	0.42
404	0.39
405	0.39
406	0.37
407	0.36
408	0.3
409	0.25
410	0.23
411	0.24
412	0.27
413	0.22
414	0.22
415	0.22
416	0.27
417	0.27
418	0.27
419	0.25
420	0.19
421	0.19
422	0.15
423	0.15
424	0.1
425	0.11
426	0.18
427	0.24
428	0.27
429	0.36
430	0.42
431	0.46
432	0.56
433	0.66
434	0.67
435	0.72
436	0.8
437	0.82
438	0.84
439	0.84
440	0.8
441	0.8
442	0.77

L7JYG9

3D AlphaFold-predicted Structure Viewer