Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L7JW16

Protein Details
Accession L7JW16    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
36-62NKTYNLRAIIRRKRKKNNKGHFYTIGKHydrophilic
NLS Segment(s)
PositionSequence
45-54IRRKRKKNNK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038765  Papain-like_cys_pep_sf  
IPR028889  USP_dom  
Gene Ontology GO:0004843  F:cysteine-type deubiquitinase activity  
PROSITE View protein in PROSITE  
PS50235  USP_3  
Amino Acid Sequences MEKNDFTLPKILVISAEPVYRKQLTLPLSEKLVFKNKTYNLRAIIRRKRKKNNKGHFYTIGKRGNSWFEFNDEIIPQIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.15
3 0.17
4 0.15
5 0.16
6 0.21
7 0.21
8 0.2
9 0.18
10 0.21
11 0.21
12 0.26
13 0.28
14 0.25
15 0.26
16 0.28
17 0.28
18 0.25
19 0.31
20 0.27
21 0.25
22 0.3
23 0.33
24 0.39
25 0.41
26 0.41
27 0.37
28 0.42
29 0.48
30 0.5
31 0.56
32 0.59
33 0.66
34 0.72
35 0.79
36 0.84
37 0.88
38 0.89
39 0.91
40 0.9
41 0.88
42 0.85
43 0.82
44 0.78
45 0.74
46 0.71
47 0.67
48 0.57
49 0.52
50 0.47
51 0.47
52 0.43
53 0.41
54 0.33
55 0.31
56 0.33
57 0.32
58 0.32
59 0.24