Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7JYK1

Protein Details
Accession L7JYK1    Localization Confidence High Confidence Score 17.3
NoLS Segment(s)
PositionSequenceProtein Nature
16-35KTPFPRKSKKFDLSKSQKAFHydrophilic
55-82MDMIRKSQDKKVKKYLRKRLGSLKCAKKHydrophilic
NLS Segment(s)
PositionSequence
16-24KTPFPRKSK
64-77KKVKKYLRKRLGSL
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038097  L36e_sf  
IPR000509  Ribosomal_L36e  
Gene Ontology GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01158  Ribosomal_L36e  
Amino Acid Sequences MILNKKARALHHKTVKTPFPRKSKKFDLSKSQKAFFARDIVKEIVGKAPYELCAMDMIRKSQDKKVKKYLRKRLGSLKCAKKKIDALTNEIHQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.73
4 0.73
5 0.72
6 0.72
7 0.78
8 0.77
9 0.78
10 0.8
11 0.79
12 0.79
13 0.78
14 0.78
15 0.77
16 0.81
17 0.78
18 0.69
19 0.63
20 0.56
21 0.51
22 0.41
23 0.38
24 0.3
25 0.26
26 0.28
27 0.25
28 0.24
29 0.22
30 0.2
31 0.16
32 0.15
33 0.14
34 0.1
35 0.1
36 0.1
37 0.1
38 0.1
39 0.07
40 0.08
41 0.08
42 0.11
43 0.11
44 0.12
45 0.15
46 0.19
47 0.21
48 0.27
49 0.36
50 0.41
51 0.48
52 0.58
53 0.65
54 0.72
55 0.8
56 0.84
57 0.85
58 0.84
59 0.82
60 0.82
61 0.81
62 0.81
63 0.8
64 0.8
65 0.79
66 0.78
67 0.74
68 0.71
69 0.68
70 0.67
71 0.66
72 0.59
73 0.56