Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7JVG4

Protein Details
Accession L7JVG4   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-28GKTRNYAKKLEGRRRKEEREAEKKRLEBasic
NLS Segment(s)
PositionSequence
8-26AKKLEGRRRKEEREAEKKR
Subcellular Location(s) nucl 22.5, cyto_nucl 12.5, mito 2
Family & Domain DBs
Amino Acid Sequences MGKTRNYAKKLEGRRRKEEREAEKKRLEEMEKEKQLAEWWLIGAKDYTKEKEKEAKKVEKQMRKEINEETLRKEIEQYTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.82
3 0.82
4 0.83
5 0.82
6 0.81
7 0.82
8 0.82
9 0.8
10 0.77
11 0.7
12 0.63
13 0.59
14 0.51
15 0.47
16 0.47
17 0.48
18 0.45
19 0.45
20 0.42
21 0.36
22 0.35
23 0.28
24 0.21
25 0.11
26 0.08
27 0.09
28 0.08
29 0.08
30 0.08
31 0.07
32 0.1
33 0.12
34 0.15
35 0.2
36 0.21
37 0.25
38 0.34
39 0.38
40 0.44
41 0.51
42 0.58
43 0.58
44 0.68
45 0.73
46 0.73
47 0.75
48 0.76
49 0.76
50 0.7
51 0.67
52 0.6
53 0.6
54 0.6
55 0.56
56 0.51
57 0.47
58 0.45
59 0.42
60 0.42
61 0.38