Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7JU18

Protein Details
Accession L7JU18   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MCELRFCGTKRKTKRTENQDTNDIFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto 7, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR031493  Zinc_ribbon_15  
Pfam View protein in Pfam  
PF17032  zinc_ribbon_15  
Amino Acid Sequences MCELRFCGTKRKTKRTENQDTNDIFCPYCACSTKSVWLIDTMYFTFCFLPLYTIYNSSEYIGCKNCYKKLGDRSVKTCERCTNVIIAGYRYCGRCGQAVEP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.89
4 0.89
5 0.85
6 0.82
7 0.75
8 0.67
9 0.6
10 0.51
11 0.39
12 0.29
13 0.24
14 0.17
15 0.19
16 0.18
17 0.16
18 0.18
19 0.2
20 0.25
21 0.28
22 0.27
23 0.23
24 0.23
25 0.22
26 0.2
27 0.19
28 0.14
29 0.12
30 0.11
31 0.11
32 0.09
33 0.08
34 0.08
35 0.07
36 0.08
37 0.07
38 0.1
39 0.1
40 0.11
41 0.12
42 0.13
43 0.13
44 0.12
45 0.13
46 0.11
47 0.14
48 0.15
49 0.15
50 0.19
51 0.22
52 0.25
53 0.27
54 0.3
55 0.35
56 0.42
57 0.52
58 0.56
59 0.58
60 0.6
61 0.65
62 0.69
63 0.64
64 0.6
65 0.56
66 0.52
67 0.48
68 0.45
69 0.39
70 0.34
71 0.34
72 0.3
73 0.27
74 0.23
75 0.24
76 0.26
77 0.24
78 0.24
79 0.22
80 0.23
81 0.24