Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7JTX8

Protein Details
Accession L7JTX8   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
293-312VYCAETKKYCDKKPEICFFLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR045098  Fyv10_fam  
Gene Ontology GO:0004842  F:ubiquitin-protein transferase activity  
GO:0043161  P:proteasome-mediated ubiquitin-dependent protein catabolic process  
Amino Acid Sequences MTESFINEAELLLFTRNTARLIKKLMDMHFKGKVSKEQLKEKLLLLKESLKKKFAALEQNDGLKPIDNLDYAIQEYLEQNDIYIYEQRIPYFEKLKQKEENIRKNDLEELQIFCEANKVLLKELKSDLMENLKVRIFIIHCCNKEYSEAIQFVRAKQISVDIMREWLFLLVRDYNLHMSKINEHLNNLVNEYKRILCHIKGLPSQTRLTNRIVAGIIALNSIDCLNKRRVDDCPTCLPWIQSLAAKLPYSRRTNTFLRCKGSNEEINESNRPLVYETRHIYSEKYLKTCGYVVYCAETKKYCDKKPEICFFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.14
3 0.15
4 0.17
5 0.23
6 0.26
7 0.3
8 0.35
9 0.38
10 0.4
11 0.46
12 0.49
13 0.52
14 0.52
15 0.52
16 0.53
17 0.52
18 0.5
19 0.47
20 0.49
21 0.48
22 0.53
23 0.54
24 0.58
25 0.63
26 0.64
27 0.62
28 0.57
29 0.56
30 0.5
31 0.45
32 0.38
33 0.39
34 0.42
35 0.48
36 0.5
37 0.44
38 0.43
39 0.42
40 0.45
41 0.43
42 0.46
43 0.41
44 0.44
45 0.45
46 0.49
47 0.47
48 0.42
49 0.36
50 0.27
51 0.23
52 0.17
53 0.16
54 0.12
55 0.13
56 0.13
57 0.13
58 0.13
59 0.13
60 0.11
61 0.09
62 0.1
63 0.1
64 0.11
65 0.09
66 0.09
67 0.09
68 0.09
69 0.1
70 0.13
71 0.12
72 0.14
73 0.16
74 0.16
75 0.17
76 0.21
77 0.23
78 0.24
79 0.29
80 0.35
81 0.39
82 0.45
83 0.49
84 0.52
85 0.58
86 0.64
87 0.68
88 0.63
89 0.65
90 0.59
91 0.55
92 0.52
93 0.43
94 0.36
95 0.28
96 0.24
97 0.19
98 0.2
99 0.18
100 0.14
101 0.15
102 0.12
103 0.11
104 0.11
105 0.1
106 0.11
107 0.14
108 0.15
109 0.16
110 0.17
111 0.18
112 0.17
113 0.17
114 0.17
115 0.18
116 0.2
117 0.17
118 0.18
119 0.16
120 0.16
121 0.15
122 0.15
123 0.12
124 0.13
125 0.21
126 0.25
127 0.25
128 0.27
129 0.28
130 0.26
131 0.27
132 0.25
133 0.2
134 0.17
135 0.18
136 0.17
137 0.21
138 0.21
139 0.2
140 0.24
141 0.22
142 0.18
143 0.16
144 0.17
145 0.14
146 0.14
147 0.15
148 0.1
149 0.11
150 0.11
151 0.11
152 0.1
153 0.09
154 0.08
155 0.07
156 0.09
157 0.07
158 0.08
159 0.08
160 0.09
161 0.12
162 0.13
163 0.14
164 0.13
165 0.13
166 0.15
167 0.19
168 0.23
169 0.2
170 0.2
171 0.22
172 0.24
173 0.24
174 0.23
175 0.22
176 0.17
177 0.17
178 0.19
179 0.17
180 0.14
181 0.18
182 0.19
183 0.16
184 0.22
185 0.24
186 0.29
187 0.3
188 0.35
189 0.36
190 0.36
191 0.38
192 0.36
193 0.39
194 0.36
195 0.35
196 0.35
197 0.3
198 0.29
199 0.27
200 0.22
201 0.17
202 0.15
203 0.12
204 0.08
205 0.07
206 0.05
207 0.05
208 0.06
209 0.06
210 0.06
211 0.1
212 0.15
213 0.19
214 0.22
215 0.24
216 0.28
217 0.36
218 0.41
219 0.42
220 0.45
221 0.44
222 0.44
223 0.43
224 0.39
225 0.32
226 0.29
227 0.25
228 0.19
229 0.18
230 0.19
231 0.22
232 0.21
233 0.22
234 0.26
235 0.32
236 0.36
237 0.38
238 0.39
239 0.41
240 0.49
241 0.56
242 0.6
243 0.59
244 0.59
245 0.57
246 0.57
247 0.57
248 0.57
249 0.54
250 0.48
251 0.47
252 0.46
253 0.48
254 0.47
255 0.43
256 0.37
257 0.31
258 0.27
259 0.24
260 0.24
261 0.24
262 0.29
263 0.31
264 0.33
265 0.35
266 0.35
267 0.34
268 0.38
269 0.42
270 0.39
271 0.39
272 0.38
273 0.37
274 0.39
275 0.39
276 0.35
277 0.3
278 0.26
279 0.24
280 0.28
281 0.3
282 0.28
283 0.31
284 0.29
285 0.31
286 0.39
287 0.47
288 0.48
289 0.55
290 0.63
291 0.68
292 0.76