Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7K0M5

Protein Details
Accession L7K0M5   
Localization Confidence High
Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
11-91GMVIRRKKEEISKQRRKRREKMDDRKKESKEDRTERSLRKARKMKKKADDVKDTNTKTCEMKQEKHKKKRGRPSNSKIELNBasic
102-123DSCVIEKKTKKIEEKVKKTEKRBasic
NLS Segment(s)
PositionSequence
15-58RRKKEEISKQRRKRREKMDDRKKESKEDRTERSLRKARKMKKKA
74-87EKHKKKRGRPSNSK
108-123KKTKKIEEKVKKTEKR
Subcellular Location(s) nucl 21, mito_nucl 13.833, cyto_nucl 11.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences VLLHRINLPLGMVIRRKKEEISKQRRKRREKMDDRKKESKEDRTERSLRKARKMKKKADDVKDTNTKTCEMKQEKHKKKRGRPSNSKIELNPIKSKSEMKADSCVIEKKTKKIEEKVKKTEKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.37
3 0.39
4 0.41
5 0.49
6 0.55
7 0.59
8 0.65
9 0.7
10 0.77
11 0.86
12 0.91
13 0.91
14 0.9
15 0.9
16 0.9
17 0.9
18 0.91
19 0.92
20 0.93
21 0.92
22 0.91
23 0.83
24 0.81
25 0.77
26 0.76
27 0.75
28 0.72
29 0.68
30 0.67
31 0.72
32 0.66
33 0.68
34 0.66
35 0.61
36 0.63
37 0.67
38 0.68
39 0.72
40 0.77
41 0.77
42 0.77
43 0.83
44 0.82
45 0.81
46 0.81
47 0.73
48 0.71
49 0.7
50 0.62
51 0.53
52 0.45
53 0.38
54 0.3
55 0.29
56 0.32
57 0.29
58 0.35
59 0.44
60 0.54
61 0.63
62 0.72
63 0.79
64 0.79
65 0.84
66 0.88
67 0.88
68 0.88
69 0.88
70 0.87
71 0.89
72 0.86
73 0.8
74 0.69
75 0.68
76 0.63
77 0.58
78 0.56
79 0.47
80 0.43
81 0.41
82 0.43
83 0.37
84 0.4
85 0.39
86 0.34
87 0.38
88 0.37
89 0.37
90 0.37
91 0.39
92 0.33
93 0.38
94 0.38
95 0.4
96 0.49
97 0.55
98 0.59
99 0.64
100 0.72
101 0.74
102 0.81
103 0.85