Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7JS81

Protein Details
Accession L7JS81   
Localization Confidence High
Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
104-123ISPSKERRRAGKSRDEYRGRBasic
NLS Segment(s)
PositionSequence
108-128KERRRAGKSRDEYRGREEYKR
Subcellular Location(s) nucl 20, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007854  Fip1_dom  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF05182  Fip1  
Amino Acid Sequences MNDDILYDVNLDDQSSESSTHLEVIAEQSRKEVSAIPEMPTIAGKNLFEFEIDTIEDKPWRRPGADITDYFNYGFDEHTWKLYCAKQRSLKEEYKDDNKETGEISPSKERRRAGKSRDEYRGREEYKRRHGYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.1
5 0.12
6 0.12
7 0.12
8 0.12
9 0.1
10 0.09
11 0.13
12 0.19
13 0.19
14 0.18
15 0.19
16 0.19
17 0.19
18 0.19
19 0.18
20 0.15
21 0.22
22 0.24
23 0.24
24 0.25
25 0.25
26 0.24
27 0.21
28 0.19
29 0.11
30 0.11
31 0.09
32 0.09
33 0.1
34 0.1
35 0.09
36 0.09
37 0.08
38 0.08
39 0.08
40 0.08
41 0.08
42 0.09
43 0.12
44 0.12
45 0.16
46 0.2
47 0.21
48 0.2
49 0.21
50 0.24
51 0.3
52 0.33
53 0.3
54 0.28
55 0.28
56 0.28
57 0.27
58 0.23
59 0.15
60 0.11
61 0.1
62 0.07
63 0.11
64 0.11
65 0.14
66 0.15
67 0.15
68 0.18
69 0.22
70 0.28
71 0.28
72 0.36
73 0.42
74 0.46
75 0.52
76 0.56
77 0.58
78 0.55
79 0.57
80 0.56
81 0.56
82 0.56
83 0.52
84 0.48
85 0.42
86 0.38
87 0.32
88 0.28
89 0.23
90 0.2
91 0.23
92 0.29
93 0.34
94 0.4
95 0.45
96 0.47
97 0.51
98 0.59
99 0.64
100 0.63
101 0.68
102 0.71
103 0.75
104 0.81
105 0.79
106 0.75
107 0.72
108 0.74
109 0.67
110 0.67
111 0.68
112 0.68
113 0.72