Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7JSF1

Protein Details
Accession L7JSF1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
78-97VNVGLLTKNKSTRRKKQNKNHydrophilic
NLS Segment(s)
PositionSequence
87-96KSTRRKKQNK
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
Amino Acid Sequences MIRKKRKIKLFQTMPSLINEIKKNSAYKNITMSKVKFMQDRIVELGAHKKKTFLPFKEGIMKSVEEKEAIRRERQMRVNVGLLTKNKSTRRKKQNKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.58
3 0.52
4 0.42
5 0.38
6 0.34
7 0.28
8 0.28
9 0.3
10 0.3
11 0.29
12 0.37
13 0.35
14 0.34
15 0.4
16 0.41
17 0.42
18 0.45
19 0.44
20 0.4
21 0.41
22 0.41
23 0.35
24 0.32
25 0.34
26 0.29
27 0.3
28 0.26
29 0.23
30 0.21
31 0.19
32 0.26
33 0.23
34 0.24
35 0.22
36 0.22
37 0.24
38 0.32
39 0.4
40 0.33
41 0.37
42 0.37
43 0.4
44 0.48
45 0.45
46 0.38
47 0.33
48 0.3
49 0.26
50 0.26
51 0.24
52 0.15
53 0.16
54 0.21
55 0.27
56 0.29
57 0.3
58 0.35
59 0.39
60 0.46
61 0.53
62 0.52
63 0.5
64 0.51
65 0.52
66 0.46
67 0.44
68 0.41
69 0.37
70 0.35
71 0.34
72 0.38
73 0.43
74 0.52
75 0.6
76 0.65
77 0.74