Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

L7K099

Protein Details
Accession L7K099    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
90-109EAIGKESKKKRPKSAYNVFVHydrophilic
NLS Segment(s)
PositionSequence
97-101KKKRP
Subcellular Location(s) nucl 15.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PF09011  HMG_box_2  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MPKKSRQRLAHAPKKPASSYLSFCSHLRKTDEALKSMAPSDQRQHFATKWRTLSDTDRKGYEDDYQQRLQAYREEYKKYKASDLYKQDCEAIGKESKKKRPKSAYNVFVAEEYKKVEGSSFGEHTAELSRRWKSMNEEEKMVFRRKAEELRKENMEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.68
3 0.61
4 0.56
5 0.51
6 0.47
7 0.44
8 0.42
9 0.39
10 0.38
11 0.42
12 0.39
13 0.38
14 0.38
15 0.35
16 0.35
17 0.41
18 0.44
19 0.39
20 0.38
21 0.33
22 0.3
23 0.29
24 0.27
25 0.21
26 0.2
27 0.24
28 0.27
29 0.3
30 0.3
31 0.33
32 0.33
33 0.4
34 0.44
35 0.44
36 0.41
37 0.39
38 0.4
39 0.39
40 0.45
41 0.45
42 0.45
43 0.4
44 0.39
45 0.38
46 0.37
47 0.36
48 0.31
49 0.29
50 0.28
51 0.32
52 0.31
53 0.31
54 0.31
55 0.3
56 0.27
57 0.23
58 0.22
59 0.23
60 0.27
61 0.31
62 0.32
63 0.36
64 0.39
65 0.36
66 0.36
67 0.35
68 0.36
69 0.39
70 0.46
71 0.47
72 0.44
73 0.43
74 0.4
75 0.35
76 0.31
77 0.24
78 0.18
79 0.18
80 0.2
81 0.27
82 0.34
83 0.43
84 0.51
85 0.57
86 0.64
87 0.69
88 0.75
89 0.78
90 0.81
91 0.78
92 0.74
93 0.69
94 0.59
95 0.5
96 0.41
97 0.32
98 0.23
99 0.18
100 0.14
101 0.12
102 0.12
103 0.11
104 0.12
105 0.14
106 0.18
107 0.17
108 0.17
109 0.17
110 0.17
111 0.18
112 0.2
113 0.19
114 0.17
115 0.21
116 0.22
117 0.23
118 0.26
119 0.28
120 0.31
121 0.41
122 0.47
123 0.46
124 0.48
125 0.48
126 0.54
127 0.55
128 0.54
129 0.46
130 0.37
131 0.39
132 0.4
133 0.49
134 0.52
135 0.57
136 0.57
137 0.62