Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3RWJ7

Protein Details
Accession E3RWJ7    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
96-115QDYKKQQQARPRPHKYPPPPHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.5, cyto 13, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
IPR042225  Ncb2  
Gene Ontology GO:0017054  C:negative cofactor 2 complex  
GO:0003682  F:chromatin binding  
GO:0001046  F:core promoter sequence-specific DNA binding  
GO:0140223  F:general transcription initiation factor activity  
GO:0046982  F:protein heterodimerization activity  
GO:0017025  F:TBP-class protein binding  
GO:0003713  F:transcription coactivator activity  
GO:0003714  F:transcription corepressor activity  
GO:0017055  P:negative regulation of RNA polymerase II transcription preinitiation complex assembly  
GO:0016480  P:negative regulation of transcription by RNA polymerase III  
GO:0045944  P:positive regulation of transcription by RNA polymerase II  
GO:0051123  P:RNA polymerase II preinitiation complex assembly  
KEGG pte:PTT_13673  -  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences MSDREFGGNDDLSLPKATVQKIVQDILASEPGMTFAKDSRDLLIECCVEFITLISSEANEIAEKDAKKTIACEHVKAALEELDFGDYVPAILEVAQDYKKQQQARPRPHKYPPPPANPSQNREKKQTKIEQSGMTEEQLIAAQEELFKTATNKFNAPPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.19
4 0.19
5 0.23
6 0.24
7 0.28
8 0.3
9 0.31
10 0.27
11 0.23
12 0.23
13 0.19
14 0.2
15 0.14
16 0.11
17 0.1
18 0.11
19 0.11
20 0.11
21 0.09
22 0.09
23 0.13
24 0.15
25 0.16
26 0.15
27 0.18
28 0.18
29 0.19
30 0.21
31 0.18
32 0.16
33 0.16
34 0.14
35 0.11
36 0.1
37 0.09
38 0.07
39 0.06
40 0.07
41 0.06
42 0.06
43 0.07
44 0.07
45 0.07
46 0.05
47 0.05
48 0.06
49 0.1
50 0.11
51 0.12
52 0.14
53 0.14
54 0.14
55 0.15
56 0.17
57 0.23
58 0.24
59 0.23
60 0.23
61 0.26
62 0.27
63 0.25
64 0.22
65 0.14
66 0.13
67 0.12
68 0.1
69 0.07
70 0.06
71 0.06
72 0.05
73 0.04
74 0.04
75 0.03
76 0.03
77 0.02
78 0.03
79 0.03
80 0.03
81 0.06
82 0.07
83 0.07
84 0.09
85 0.14
86 0.19
87 0.23
88 0.26
89 0.34
90 0.44
91 0.55
92 0.64
93 0.67
94 0.69
95 0.74
96 0.81
97 0.79
98 0.8
99 0.77
100 0.76
101 0.74
102 0.73
103 0.76
104 0.72
105 0.69
106 0.69
107 0.69
108 0.64
109 0.67
110 0.69
111 0.65
112 0.67
113 0.72
114 0.7
115 0.69
116 0.71
117 0.67
118 0.63
119 0.61
120 0.53
121 0.43
122 0.35
123 0.26
124 0.21
125 0.16
126 0.14
127 0.09
128 0.08
129 0.08
130 0.08
131 0.09
132 0.1
133 0.09
134 0.1
135 0.12
136 0.18
137 0.24
138 0.27
139 0.3