Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E3RU73

Protein Details
Accession E3RU73    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MSRSGKKPTKPLAQNPQKTMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, mito_nucl 13, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005146  B3/B4_tRNA-bd  
IPR020825  Phe-tRNA_synthase-like_B3/B4  
Gene Ontology GO:0004826  F:phenylalanine-tRNA ligase activity  
GO:0003723  F:RNA binding  
KEGG pte:PTT_12619  -  
Pfam View protein in Pfam  
PF03483  B3_4  
Amino Acid Sequences MSRSGKKPTKPLAQNPQKTMNSLETLRRVNAGLPRVNRLTDIYNGISIKHQIPLGGEDIDKYNGSPILRRAKGDEQFETMSGGEVAIEYPTPGEDVWCGDKGVTCRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.8
4 0.71
5 0.64
6 0.57
7 0.49
8 0.43
9 0.37
10 0.37
11 0.32
12 0.33
13 0.32
14 0.29
15 0.26
16 0.24
17 0.27
18 0.27
19 0.27
20 0.26
21 0.3
22 0.31
23 0.3
24 0.28
25 0.25
26 0.22
27 0.19
28 0.21
29 0.17
30 0.18
31 0.17
32 0.17
33 0.16
34 0.15
35 0.14
36 0.12
37 0.11
38 0.09
39 0.1
40 0.11
41 0.11
42 0.1
43 0.09
44 0.08
45 0.09
46 0.1
47 0.1
48 0.08
49 0.08
50 0.09
51 0.1
52 0.11
53 0.16
54 0.24
55 0.26
56 0.27
57 0.31
58 0.36
59 0.42
60 0.44
61 0.4
62 0.35
63 0.35
64 0.34
65 0.3
66 0.22
67 0.17
68 0.13
69 0.11
70 0.07
71 0.06
72 0.06
73 0.05
74 0.05
75 0.04
76 0.04
77 0.05
78 0.06
79 0.06
80 0.06
81 0.07
82 0.1
83 0.14
84 0.15
85 0.15
86 0.15
87 0.19