Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

L7JVI3

Protein Details
Accession L7JVI3    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
53-75LEESIRKFKEKRNKKMREIYDIVHydrophilic
NLS Segment(s)
PositionSequence
59-67KFKEKRNKK
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MTGVIEHNEREENGKGYATEIVKKFAAIDVIIDEFDTKIYEKINEIKEYRNNLEESIRKFKEKRNKKMREIYDIVSSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.18
3 0.17
4 0.22
5 0.19
6 0.23
7 0.21
8 0.23
9 0.22
10 0.22
11 0.21
12 0.17
13 0.16
14 0.1
15 0.09
16 0.08
17 0.08
18 0.08
19 0.07
20 0.07
21 0.06
22 0.06
23 0.06
24 0.05
25 0.05
26 0.06
27 0.07
28 0.08
29 0.14
30 0.18
31 0.21
32 0.22
33 0.26
34 0.31
35 0.36
36 0.37
37 0.34
38 0.31
39 0.28
40 0.33
41 0.33
42 0.34
43 0.39
44 0.38
45 0.4
46 0.43
47 0.5
48 0.55
49 0.61
50 0.66
51 0.67
52 0.75
53 0.8
54 0.88
55 0.86
56 0.85
57 0.79
58 0.71