Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q59RN6

Protein Details
Accession Q59RN6    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
33-62ESKKRAVEPSTDKKKKRRRRNYDEEDKELEBasic
NLS Segment(s)
PositionSequence
36-52KRAVEPSTDKKKKRRRR
Subcellular Location(s) nucl 20.5, cyto_nucl 12.833, cyto 4, cyto_pero 2.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR019098  Histone_chaperone_domain_CHZ  
Gene Ontology GO:0005634  C:nucleus  
KEGG cal:CAALFM_CR07230WA  -  
Pfam View protein in Pfam  
PF09649  CHZ  
Amino Acid Sequences MSDESKPIEEPPIESKPQEEQDTEKESLTNSEESKKRAVEPSTDKKKKRRRRNYDEEDKELEKEEAKEKNAKTENNEEGDDDEDDEDDDYEQGKLEDEEEEEDELLEIDESNIITTGRRTRGKVIDFTKAAEELDKERGVVAEEDEEEEEEEEKENEDDDFKEQVQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.33
3 0.34
4 0.39
5 0.39
6 0.34
7 0.32
8 0.36
9 0.42
10 0.41
11 0.35
12 0.29
13 0.26
14 0.27
15 0.25
16 0.23
17 0.18
18 0.25
19 0.28
20 0.3
21 0.34
22 0.33
23 0.33
24 0.36
25 0.37
26 0.37
27 0.43
28 0.51
29 0.58
30 0.66
31 0.69
32 0.72
33 0.81
34 0.84
35 0.86
36 0.86
37 0.86
38 0.88
39 0.93
40 0.93
41 0.94
42 0.9
43 0.84
44 0.78
45 0.67
46 0.57
47 0.48
48 0.37
49 0.28
50 0.23
51 0.22
52 0.21
53 0.22
54 0.28
55 0.26
56 0.34
57 0.37
58 0.37
59 0.36
60 0.4
61 0.41
62 0.37
63 0.37
64 0.28
65 0.25
66 0.24
67 0.2
68 0.13
69 0.09
70 0.07
71 0.06
72 0.06
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.05
83 0.05
84 0.05
85 0.07
86 0.08
87 0.08
88 0.07
89 0.07
90 0.07
91 0.06
92 0.06
93 0.04
94 0.03
95 0.03
96 0.04
97 0.04
98 0.04
99 0.04
100 0.04
101 0.05
102 0.07
103 0.13
104 0.19
105 0.23
106 0.25
107 0.31
108 0.39
109 0.42
110 0.48
111 0.46
112 0.47
113 0.45
114 0.44
115 0.39
116 0.33
117 0.29
118 0.23
119 0.21
120 0.15
121 0.2
122 0.18
123 0.17
124 0.16
125 0.16
126 0.17
127 0.16
128 0.14
129 0.11
130 0.12
131 0.13
132 0.14
133 0.14
134 0.12
135 0.12
136 0.12
137 0.1
138 0.11
139 0.1
140 0.11
141 0.1
142 0.1
143 0.1
144 0.11
145 0.12
146 0.14
147 0.17